Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XP30

Protein Details
Accession A0A4Q4XP30   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-145NSQPCAGTRKRNRLRKKGNSRSESPYHydrophilic
NLS Segment(s)
PositionSequence
128-143RKRNRLRKKGNSRSES
152-161KPPRGLRGPP
Subcellular Location(s) mito 10, cyto 6.5, extr 6, cyto_nucl 5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MPPSGGRCPDRGLLTSQGVVGYQRGTPVFGYQYGYPMPETAGATTLAAGMPRDSDAFPVSRAPRSPTEQMRTNRACSFELLACAHLSSESSSAYRDAWGQTAEDSHSHHNEAISDNYHGNSQPCAGTRKRNRLRKKGNSRSESPYHGPYPYKPPRGLRGPPGPPGEAGPPGSRGEQGLQGIPVSDSLRLAHDVVLIKSSRESVYPVHRDPRGAPGVAGPAGPAGQPGPSGPQGLPGVAGREGPQGLQGIPGSQGDPGTAGRDGRDGRDGADGRDGRDGRDGVDGRDGADGKDGVDGRDGEMGSADLREKLGQRVNAVLAVGVATRALGATKAPGDARVVVAPGEIVGVIAAIAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.3
4 0.26
5 0.22
6 0.21
7 0.18
8 0.13
9 0.11
10 0.14
11 0.13
12 0.14
13 0.15
14 0.17
15 0.18
16 0.18
17 0.21
18 0.18
19 0.21
20 0.21
21 0.22
22 0.19
23 0.17
24 0.16
25 0.16
26 0.16
27 0.13
28 0.14
29 0.13
30 0.12
31 0.12
32 0.12
33 0.09
34 0.08
35 0.08
36 0.07
37 0.07
38 0.08
39 0.1
40 0.1
41 0.11
42 0.13
43 0.14
44 0.14
45 0.21
46 0.23
47 0.25
48 0.27
49 0.3
50 0.34
51 0.39
52 0.46
53 0.47
54 0.51
55 0.56
56 0.57
57 0.63
58 0.61
59 0.6
60 0.55
61 0.49
62 0.44
63 0.37
64 0.37
65 0.28
66 0.28
67 0.24
68 0.22
69 0.19
70 0.17
71 0.15
72 0.11
73 0.11
74 0.08
75 0.08
76 0.08
77 0.09
78 0.09
79 0.1
80 0.11
81 0.11
82 0.11
83 0.11
84 0.12
85 0.12
86 0.12
87 0.11
88 0.12
89 0.13
90 0.12
91 0.14
92 0.16
93 0.17
94 0.18
95 0.18
96 0.17
97 0.17
98 0.18
99 0.18
100 0.15
101 0.15
102 0.15
103 0.14
104 0.15
105 0.15
106 0.14
107 0.12
108 0.12
109 0.12
110 0.13
111 0.18
112 0.2
113 0.29
114 0.37
115 0.47
116 0.55
117 0.64
118 0.72
119 0.78
120 0.86
121 0.87
122 0.9
123 0.9
124 0.9
125 0.86
126 0.82
127 0.77
128 0.7
129 0.65
130 0.56
131 0.5
132 0.41
133 0.38
134 0.34
135 0.29
136 0.36
137 0.39
138 0.41
139 0.4
140 0.42
141 0.46
142 0.52
143 0.53
144 0.5
145 0.5
146 0.48
147 0.5
148 0.5
149 0.43
150 0.36
151 0.34
152 0.28
153 0.21
154 0.19
155 0.14
156 0.13
157 0.14
158 0.14
159 0.13
160 0.12
161 0.11
162 0.12
163 0.12
164 0.1
165 0.09
166 0.09
167 0.09
168 0.08
169 0.08
170 0.07
171 0.06
172 0.06
173 0.06
174 0.07
175 0.08
176 0.08
177 0.07
178 0.09
179 0.11
180 0.1
181 0.12
182 0.11
183 0.11
184 0.11
185 0.12
186 0.1
187 0.09
188 0.11
189 0.12
190 0.2
191 0.25
192 0.27
193 0.31
194 0.32
195 0.32
196 0.32
197 0.36
198 0.31
199 0.25
200 0.23
201 0.19
202 0.2
203 0.19
204 0.18
205 0.1
206 0.07
207 0.07
208 0.07
209 0.06
210 0.04
211 0.04
212 0.05
213 0.05
214 0.08
215 0.09
216 0.1
217 0.1
218 0.14
219 0.14
220 0.14
221 0.15
222 0.12
223 0.13
224 0.12
225 0.12
226 0.09
227 0.11
228 0.11
229 0.1
230 0.11
231 0.1
232 0.1
233 0.11
234 0.1
235 0.09
236 0.1
237 0.1
238 0.09
239 0.09
240 0.09
241 0.07
242 0.08
243 0.08
244 0.09
245 0.1
246 0.09
247 0.1
248 0.14
249 0.15
250 0.16
251 0.19
252 0.17
253 0.17
254 0.25
255 0.25
256 0.22
257 0.3
258 0.28
259 0.26
260 0.34
261 0.33
262 0.26
263 0.3
264 0.29
265 0.22
266 0.29
267 0.29
268 0.22
269 0.27
270 0.26
271 0.22
272 0.25
273 0.24
274 0.16
275 0.19
276 0.17
277 0.13
278 0.17
279 0.17
280 0.14
281 0.16
282 0.16
283 0.15
284 0.18
285 0.18
286 0.13
287 0.13
288 0.13
289 0.1
290 0.11
291 0.11
292 0.08
293 0.09
294 0.12
295 0.13
296 0.19
297 0.25
298 0.26
299 0.27
300 0.3
301 0.3
302 0.28
303 0.27
304 0.2
305 0.14
306 0.12
307 0.1
308 0.07
309 0.06
310 0.04
311 0.04
312 0.04
313 0.05
314 0.05
315 0.05
316 0.08
317 0.1
318 0.13
319 0.13
320 0.15
321 0.17
322 0.18
323 0.2
324 0.18
325 0.18
326 0.15
327 0.15
328 0.13
329 0.1
330 0.09
331 0.07
332 0.05
333 0.04
334 0.04