Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Y6Y6

Protein Details
Accession A0A4Q4Y6Y6    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-93FPPPLQRHQQARQRQHHHQHHQHPQAAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018860  APC_suCDC26  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
Pfam View protein in Pfam  
PF10471  ANAPC_CDC26  
Amino Acid Sequences MLRRPPTTLTLTAEDIASYEDRRAAALAAASQSQQSSSSPLLLAHQHQHSNNNNNSLLNAHGRVRFPPPLQRHQQARQRQHHHQHHQHPQAAPAPALDSSPPPGPGPDISSSGSNGSSADEDMEDADAGEDERGEEQEEVEEEQEEEVEDDDDPFVTRPGRRRAAAAQVRAQQAQARIAGRSGAAQAAARRMRAHGTGTGAQTQQAQAQTAAQQRAQRIGVAAAPPQPQPQPQPSHAHAHQTRRTASRQGSEPAPPPALPQQPPPQTQQQQQQQQLLQQQGRVTRSRDERIAGTASASSASSSSLTGGGERAGTGGAARRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.19
4 0.16
5 0.13
6 0.12
7 0.13
8 0.13
9 0.14
10 0.14
11 0.12
12 0.12
13 0.12
14 0.13
15 0.13
16 0.13
17 0.13
18 0.13
19 0.13
20 0.12
21 0.12
22 0.11
23 0.13
24 0.13
25 0.15
26 0.14
27 0.15
28 0.17
29 0.19
30 0.22
31 0.24
32 0.28
33 0.32
34 0.33
35 0.41
36 0.46
37 0.51
38 0.52
39 0.52
40 0.48
41 0.43
42 0.42
43 0.35
44 0.3
45 0.25
46 0.23
47 0.21
48 0.24
49 0.24
50 0.26
51 0.3
52 0.34
53 0.33
54 0.39
55 0.43
56 0.48
57 0.55
58 0.6
59 0.63
60 0.67
61 0.73
62 0.74
63 0.77
64 0.78
65 0.78
66 0.81
67 0.83
68 0.85
69 0.86
70 0.86
71 0.85
72 0.86
73 0.86
74 0.81
75 0.71
76 0.64
77 0.59
78 0.5
79 0.4
80 0.3
81 0.23
82 0.17
83 0.17
84 0.14
85 0.09
86 0.11
87 0.12
88 0.13
89 0.12
90 0.12
91 0.13
92 0.13
93 0.16
94 0.15
95 0.16
96 0.16
97 0.17
98 0.17
99 0.17
100 0.16
101 0.12
102 0.1
103 0.08
104 0.08
105 0.07
106 0.07
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.03
118 0.03
119 0.04
120 0.04
121 0.05
122 0.05
123 0.05
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.07
144 0.09
145 0.15
146 0.23
147 0.27
148 0.27
149 0.29
150 0.31
151 0.4
152 0.43
153 0.4
154 0.38
155 0.39
156 0.4
157 0.38
158 0.35
159 0.27
160 0.23
161 0.22
162 0.19
163 0.15
164 0.13
165 0.13
166 0.13
167 0.11
168 0.1
169 0.09
170 0.06
171 0.06
172 0.07
173 0.07
174 0.14
175 0.15
176 0.15
177 0.15
178 0.15
179 0.17
180 0.18
181 0.19
182 0.14
183 0.17
184 0.2
185 0.21
186 0.23
187 0.21
188 0.2
189 0.19
190 0.17
191 0.16
192 0.13
193 0.13
194 0.1
195 0.11
196 0.15
197 0.19
198 0.21
199 0.2
200 0.23
201 0.23
202 0.26
203 0.26
204 0.21
205 0.17
206 0.16
207 0.16
208 0.14
209 0.15
210 0.16
211 0.17
212 0.17
213 0.19
214 0.2
215 0.2
216 0.24
217 0.3
218 0.32
219 0.35
220 0.41
221 0.42
222 0.49
223 0.48
224 0.53
225 0.51
226 0.54
227 0.55
228 0.53
229 0.55
230 0.51
231 0.53
232 0.5
233 0.5
234 0.46
235 0.45
236 0.43
237 0.42
238 0.42
239 0.42
240 0.39
241 0.36
242 0.3
243 0.29
244 0.32
245 0.36
246 0.33
247 0.36
248 0.42
249 0.47
250 0.5
251 0.52
252 0.55
253 0.55
254 0.6
255 0.63
256 0.63
257 0.65
258 0.68
259 0.69
260 0.61
261 0.6
262 0.59
263 0.57
264 0.49
265 0.43
266 0.4
267 0.39
268 0.42
269 0.41
270 0.38
271 0.39
272 0.44
273 0.48
274 0.48
275 0.46
276 0.43
277 0.43
278 0.43
279 0.34
280 0.28
281 0.23
282 0.19
283 0.17
284 0.15
285 0.11
286 0.09
287 0.09
288 0.09
289 0.08
290 0.09
291 0.09
292 0.1
293 0.1
294 0.1
295 0.1
296 0.1
297 0.09
298 0.09
299 0.08
300 0.07
301 0.08