Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4WXS0

Protein Details
Accession A0A4Q4WXS0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
54-75YGLRSRGKGAPKKKKGPPGAKKBasic
NLS Segment(s)
PositionSequence
57-75RSRGKGAPKKKKGPPGAKK
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MVVPRSRLLDLMKANGVRMGNKILRQRLRGPSLVKYYPPRGPDLNTLARDFKDYGLRSRGKGAPKKKKGPPGAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.27
4 0.21
5 0.21
6 0.23
7 0.21
8 0.26
9 0.32
10 0.37
11 0.41
12 0.44
13 0.49
14 0.5
15 0.52
16 0.51
17 0.47
18 0.45
19 0.46
20 0.43
21 0.39
22 0.36
23 0.36
24 0.35
25 0.34
26 0.31
27 0.27
28 0.28
29 0.29
30 0.31
31 0.33
32 0.31
33 0.32
34 0.3
35 0.29
36 0.29
37 0.25
38 0.21
39 0.23
40 0.23
41 0.26
42 0.32
43 0.35
44 0.33
45 0.39
46 0.42
47 0.44
48 0.52
49 0.58
50 0.61
51 0.69
52 0.78
53 0.8
54 0.85
55 0.86