Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8Q828

Protein Details
Accession J8Q828    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-39NKNNEKFRKYGKKKVGKDDKKSAPBasic
NLS Segment(s)
PositionSequence
18-36NNEKFRKYGKKKVGKDDKK
Subcellular Location(s) mito 13, plas 5, E.R. 3, nucl 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAVQTPRQRLANAKFNKNNEKFRKYGKKKVGKDDKKSAPLISRTWLGILLFLLVGGGVLELISYIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.74
4 0.72
5 0.75
6 0.74
7 0.72
8 0.65
9 0.68
10 0.72
11 0.7
12 0.72
13 0.72
14 0.74
15 0.74
16 0.82
17 0.83
18 0.81
19 0.81
20 0.8
21 0.76
22 0.71
23 0.66
24 0.57
25 0.51
26 0.45
27 0.39
28 0.32
29 0.27
30 0.22
31 0.21
32 0.2
33 0.15
34 0.12
35 0.11
36 0.08
37 0.07
38 0.06
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.02
45 0.02
46 0.02