Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XPH0

Protein Details
Accession A0A4Q4XPH0   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSSRASTRKANNRRLKANVFHydrophilic
101-129SSSNKRAGKGRIQKRKKKANKVVFALYKDHydrophilic
NLS Segment(s)
PositionSequence
104-137NKRAGKGRIQKRKKKANKVVFALYKDKKSSKRKH
Subcellular Location(s) nucl 14, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRASTRKANNRRLKANVFGPVESARAERLSAKLLELASQPKPEAKEVKVVEDVEAAEAEGEAEAKMDEDAAAAENADDTAMDVDSNNNNNTAAKSASSSNKRAGKGRIQKRKKKANKVVFALYKDKKSSKRKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.83
4 0.77
5 0.73
6 0.68
7 0.66
8 0.58
9 0.49
10 0.44
11 0.37
12 0.32
13 0.27
14 0.22
15 0.15
16 0.13
17 0.14
18 0.13
19 0.13
20 0.15
21 0.15
22 0.15
23 0.16
24 0.15
25 0.16
26 0.16
27 0.18
28 0.17
29 0.18
30 0.18
31 0.18
32 0.2
33 0.22
34 0.25
35 0.22
36 0.28
37 0.28
38 0.31
39 0.31
40 0.29
41 0.26
42 0.22
43 0.21
44 0.13
45 0.12
46 0.08
47 0.05
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.02
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.08
76 0.1
77 0.11
78 0.11
79 0.11
80 0.12
81 0.12
82 0.13
83 0.11
84 0.09
85 0.11
86 0.14
87 0.22
88 0.27
89 0.29
90 0.36
91 0.41
92 0.43
93 0.47
94 0.49
95 0.51
96 0.56
97 0.64
98 0.67
99 0.72
100 0.8
101 0.85
102 0.9
103 0.9
104 0.91
105 0.92
106 0.92
107 0.9
108 0.87
109 0.86
110 0.81
111 0.76
112 0.74
113 0.69
114 0.64
115 0.6
116 0.62
117 0.62