Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8PX98

Protein Details
Accession J8PX98    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-104TTSFGWGKKTRQRVKKQQELFENAHydrophilic
NLS Segment(s)
PositionSequence
61-61K
64-64K
Subcellular Location(s) nucl 13, cyto_nucl 11.166, mito_nucl 8.166, cyto 8, cyto_mito 5.666, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSEVSETWIERWSAKIINYDYKHFIRLVIIVGGYLLVRNIASRELAKKQLAAQVEKDKREKEEKRSKELIDKPGEPAVGETTSFGWGKKTRQRVKKQQELFENALEEAKKRQQGMDPDSDADIEELLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.28
4 0.37
5 0.39
6 0.41
7 0.44
8 0.42
9 0.42
10 0.35
11 0.32
12 0.24
13 0.22
14 0.19
15 0.14
16 0.12
17 0.1
18 0.1
19 0.09
20 0.07
21 0.06
22 0.04
23 0.03
24 0.03
25 0.04
26 0.05
27 0.05
28 0.07
29 0.09
30 0.13
31 0.16
32 0.21
33 0.21
34 0.21
35 0.23
36 0.25
37 0.26
38 0.24
39 0.25
40 0.31
41 0.35
42 0.37
43 0.39
44 0.36
45 0.37
46 0.45
47 0.46
48 0.46
49 0.52
50 0.53
51 0.58
52 0.61
53 0.58
54 0.58
55 0.59
56 0.56
57 0.5
58 0.46
59 0.41
60 0.38
61 0.37
62 0.27
63 0.22
64 0.16
65 0.12
66 0.11
67 0.09
68 0.08
69 0.11
70 0.11
71 0.1
72 0.13
73 0.15
74 0.22
75 0.29
76 0.39
77 0.46
78 0.56
79 0.67
80 0.74
81 0.81
82 0.85
83 0.85
84 0.82
85 0.81
86 0.78
87 0.71
88 0.62
89 0.53
90 0.43
91 0.38
92 0.3
93 0.23
94 0.21
95 0.24
96 0.25
97 0.25
98 0.27
99 0.31
100 0.4
101 0.46
102 0.49
103 0.45
104 0.43
105 0.43
106 0.4
107 0.34
108 0.25
109 0.19