Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4XHD1

Protein Details
Accession A0A4Q4XHD1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-81AGLVYRMRMHRRVRRERRESRDRDSSBasic
NLS Segment(s)
PositionSequence
66-73RRVRRERR
Subcellular Location(s) mito 10, cyto 5.5, cyto_nucl 5.5, nucl 4.5, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPQDLESADDTMGARILDADDGGWHYVETRRSRGGTAFGIILATVLLLLLLATVAGLVYRMRMHRRVRRERRESRDRDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.07
4 0.07
5 0.06
6 0.06
7 0.05
8 0.05
9 0.06
10 0.07
11 0.06
12 0.06
13 0.07
14 0.1
15 0.16
16 0.19
17 0.21
18 0.23
19 0.24
20 0.25
21 0.25
22 0.25
23 0.2
24 0.18
25 0.15
26 0.12
27 0.11
28 0.09
29 0.08
30 0.05
31 0.03
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.01
38 0.01
39 0.01
40 0.01
41 0.01
42 0.02
43 0.02
44 0.02
45 0.02
46 0.04
47 0.07
48 0.11
49 0.16
50 0.24
51 0.34
52 0.42
53 0.53
54 0.64
55 0.73
56 0.8
57 0.86
58 0.89
59 0.9
60 0.92
61 0.89