Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XWR5

Protein Details
Accession A0A4V1XWR5    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
107-145RSSRLIRKRRHGFLSRLRTRNGRKTLQRRKDKKRSVLSMBasic
NLS Segment(s)
PositionSequence
107-140RSSRLIRKRRHGFLSRLRTRNGRKTLQRRKDKKR
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MRPFSLAASAVRTALSGAQSRSTIITTVSKRTFSSLPQLRPSILPPAHGTVFRPANSALSRVSLTPSAPTGATGPETLDLVPKTAITAHPAMADVQLRCGPRPTMARSSRLIRKRRHGFLSRLRTRNGRKTLQRRKDKKRSVLSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.15
5 0.17
6 0.18
7 0.18
8 0.19
9 0.18
10 0.15
11 0.14
12 0.2
13 0.2
14 0.28
15 0.3
16 0.3
17 0.3
18 0.33
19 0.32
20 0.27
21 0.35
22 0.35
23 0.38
24 0.41
25 0.42
26 0.39
27 0.39
28 0.39
29 0.37
30 0.29
31 0.26
32 0.23
33 0.25
34 0.26
35 0.25
36 0.24
37 0.21
38 0.24
39 0.22
40 0.22
41 0.19
42 0.21
43 0.21
44 0.21
45 0.16
46 0.14
47 0.14
48 0.12
49 0.14
50 0.11
51 0.1
52 0.1
53 0.1
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.07
61 0.07
62 0.06
63 0.07
64 0.06
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.09
74 0.1
75 0.09
76 0.1
77 0.1
78 0.1
79 0.11
80 0.13
81 0.1
82 0.12
83 0.15
84 0.15
85 0.15
86 0.17
87 0.17
88 0.19
89 0.24
90 0.28
91 0.34
92 0.37
93 0.41
94 0.42
95 0.49
96 0.53
97 0.57
98 0.6
99 0.57
100 0.65
101 0.7
102 0.74
103 0.76
104 0.74
105 0.75
106 0.77
107 0.8
108 0.79
109 0.75
110 0.71
111 0.71
112 0.73
113 0.74
114 0.71
115 0.7
116 0.71
117 0.77
118 0.85
119 0.86
120 0.89
121 0.89
122 0.92
123 0.94
124 0.94
125 0.93