FuNGI

J8PIT5

Protein Details

Accession

J8PIT5

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
34-53	QQQQRGKKDTITKDEKKETK	Hydrophilic

NLS Segment(s)

Position	Sequence
48-65	EKKETKGSQKKAEGGKKS

Subcellular Location(s)

nucl 8, cyto_mito 8, mito 7.5, cyto 7.5, vacu 3

Family & Domain DBs

InterPro	View protein in InterPro IPR005687 Tom70 IPR011990 TPR-like_helical_dom_sf IPR001440 TPR_1 IPR019734 TPR_repeat
Gene Ontology	GO:0005741 C:mitochondrial outer membrane GO:0015450 F:protein-transporting ATPase activity GO:0006886 P:intracellular protein transport
Pfam	View protein in Pfam PF00515 TPR_1 PF13432 TPR_16
PROSITE	View protein in PROSITE PS50005 TPR

Amino Acid Sequences

MKSFISRNKTAILATVAATGAAVGAFYYYNQLQQQQQRGKKDTITKDEKKETKGSQKKAEGGKKSAGELKAPIYPVSSNGEPDFSNKASFTAEEKEKYALALKDKGNQYFRNKKYDDAVKYYNWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKDKFGDIDAATATPTELSTQAPKDRKDKQENLPSITSMASFFGIFKPELTFANYDESVEADKELMNGLNNLYKRSPESYDKADESFTKAVNLFDDLLDKNSEDEKLKEKLAISLEHTGIFRFLKNDPLGAHEDIKRAIELFPRVNSYIYMALIMADRNDSTEYHNYFDKALKLDPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAIELEDKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAAKIQDTLAKLREQGLM

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.21
3	0.18
4	0.15
5	0.15
6	0.11
7	0.08
8	0.06
9	0.05
10	0.03
11	0.04
12	0.04
13	0.04
14	0.09
15	0.1
16	0.14
17	0.16
18	0.2
19	0.27
20	0.35
21	0.45
22	0.5
23	0.57
24	0.63
25	0.67
26	0.67
27	0.67
28	0.69
29	0.68
30	0.69
31	0.72
32	0.71
33	0.74
34	0.81
35	0.8
36	0.75
37	0.74
38	0.72
39	0.73
40	0.74
41	0.74
42	0.73
43	0.74
44	0.76
45	0.78
46	0.78
47	0.74
48	0.7
49	0.69
50	0.61
51	0.57
52	0.57
53	0.48
54	0.42
55	0.37
56	0.34
57	0.31
58	0.3
59	0.27
60	0.22
61	0.21
62	0.21
63	0.25
64	0.23
65	0.22
66	0.21
67	0.23
68	0.21
69	0.24
70	0.27
71	0.21
72	0.22
73	0.19
74	0.2
75	0.19
76	0.2
77	0.21
78	0.23
79	0.27
80	0.27
81	0.29
82	0.29
83	0.28
84	0.28
85	0.3
86	0.26
87	0.26
88	0.31
89	0.31
90	0.38
91	0.42
92	0.48
93	0.48
94	0.52
95	0.57
96	0.6
97	0.63
98	0.65
99	0.61
100	0.58
101	0.6
102	0.62
103	0.58
104	0.55
105	0.54
106	0.46
107	0.48
108	0.46
109	0.39
110	0.31
111	0.25
112	0.18
113	0.18
114	0.19
115	0.18
116	0.19
117	0.18
118	0.17
119	0.18
120	0.18
121	0.14
122	0.16
123	0.15
124	0.14
125	0.15
126	0.15
127	0.13
128	0.13
129	0.13
130	0.1
131	0.14
132	0.14
133	0.13
134	0.15
135	0.15
136	0.15
137	0.16
138	0.15
139	0.15
140	0.15
141	0.18
142	0.18
143	0.19
144	0.19
145	0.19
146	0.21
147	0.19
148	0.22
149	0.22
150	0.22
151	0.22
152	0.23
153	0.27
154	0.28
155	0.34
156	0.33
157	0.31
158	0.34
159	0.36
160	0.39
161	0.36
162	0.33
163	0.27
164	0.24
165	0.24
166	0.19
167	0.16
168	0.11
169	0.09
170	0.08
171	0.06
172	0.07
173	0.05
174	0.05
175	0.04
176	0.04
177	0.05
178	0.05
179	0.05
180	0.04
181	0.04
182	0.05
183	0.06
184	0.06
185	0.05
186	0.07
187	0.07
188	0.07
189	0.07
190	0.07
191	0.06
192	0.07
193	0.08
194	0.09
195	0.1
196	0.13
197	0.19
198	0.2
199	0.2
200	0.21
201	0.28
202	0.33
203	0.37
204	0.4
205	0.36
206	0.39
207	0.4
208	0.39
209	0.33
210	0.27
211	0.27
212	0.2
213	0.19
214	0.15
215	0.14
216	0.13
217	0.11
218	0.09
219	0.05
220	0.05
221	0.05
222	0.05
223	0.06
224	0.09
225	0.12
226	0.19
227	0.24
228	0.27
229	0.33
230	0.41
231	0.49
232	0.56
233	0.61
234	0.63
235	0.68
236	0.69
237	0.67
238	0.59
239	0.5
240	0.41
241	0.33
242	0.25
243	0.15
244	0.12
245	0.08
246	0.07
247	0.07
248	0.07
249	0.09
250	0.08
251	0.08
252	0.09
253	0.1
254	0.1
255	0.12
256	0.12
257	0.11
258	0.15
259	0.14
260	0.13
261	0.12
262	0.12
263	0.11
264	0.1
265	0.09
266	0.05
267	0.05
268	0.05
269	0.06
270	0.06
271	0.05
272	0.05
273	0.06
274	0.09
275	0.09
276	0.11
277	0.11
278	0.11
279	0.13
280	0.15
281	0.19
282	0.2
283	0.23
284	0.26
285	0.29
286	0.29
287	0.28
288	0.26
289	0.23
290	0.23
291	0.2
292	0.16
293	0.14
294	0.13
295	0.13
296	0.12
297	0.13
298	0.09
299	0.08
300	0.1
301	0.09
302	0.09
303	0.09
304	0.09
305	0.09
306	0.09
307	0.11
308	0.1
309	0.11
310	0.14
311	0.16
312	0.17
313	0.17
314	0.17
315	0.19
316	0.2
317	0.19
318	0.18
319	0.19
320	0.19
321	0.19
322	0.18
323	0.15
324	0.14
325	0.13
326	0.11
327	0.1
328	0.1
329	0.15
330	0.15
331	0.16
332	0.15
333	0.18
334	0.22
335	0.21
336	0.23
337	0.19
338	0.2
339	0.19
340	0.2
341	0.16
342	0.13
343	0.13
344	0.13
345	0.15
346	0.15
347	0.16
348	0.18
349	0.19
350	0.19
351	0.18
352	0.16
353	0.14
354	0.12
355	0.11
356	0.08
357	0.08
358	0.08
359	0.08
360	0.06
361	0.05
362	0.05
363	0.06
364	0.07
365	0.07
366	0.11
367	0.17
368	0.18
369	0.19
370	0.21
371	0.2
372	0.21
373	0.23
374	0.21
375	0.17
376	0.18
377	0.21
378	0.22
379	0.27
380	0.27
381	0.28
382	0.27
383	0.26
384	0.26
385	0.22
386	0.25
387	0.21
388	0.22
389	0.23
390	0.22
391	0.22
392	0.23
393	0.28
394	0.25
395	0.24
396	0.24
397	0.2
398	0.22
399	0.22
400	0.22
401	0.16
402	0.14
403	0.16
404	0.14
405	0.18
406	0.21
407	0.19
408	0.22
409	0.23
410	0.24
411	0.3
412	0.31
413	0.34
414	0.31
415	0.33
416	0.3
417	0.3
418	0.28
419	0.19
420	0.19
421	0.13
422	0.11
423	0.09
424	0.08
425	0.07
426	0.09
427	0.11
428	0.14
429	0.16
430	0.19
431	0.2
432	0.21
433	0.23
434	0.24
435	0.25
436	0.22
437	0.22
438	0.21
439	0.23
440	0.22
441	0.21
442	0.28
443	0.26
444	0.29
445	0.31
446	0.32
447	0.32
448	0.34
449	0.44
450	0.41
451	0.47
452	0.49
453	0.5
454	0.48
455	0.44
456	0.41
457	0.3
458	0.25
459	0.18
460	0.13
461	0.1
462	0.12
463	0.13
464	0.13
465	0.14
466	0.15
467	0.15
468	0.15
469	0.2
470	0.2
471	0.24
472	0.24
473	0.24
474	0.25
475	0.26
476	0.26
477	0.2
478	0.17
479	0.13
480	0.13
481	0.13
482	0.11
483	0.09
484	0.07
485	0.07
486	0.06
487	0.05
488	0.05
489	0.04
490	0.04
491	0.04
492	0.04
493	0.04
494	0.05
495	0.05
496	0.05
497	0.04
498	0.05
499	0.08
500	0.13
501	0.15
502	0.19
503	0.2
504	0.23
505	0.25
506	0.25
507	0.27
508	0.23
509	0.24
510	0.22
511	0.2
512	0.18
513	0.16
514	0.17
515	0.14
516	0.14
517	0.11
518	0.12
519	0.11
520	0.14
521	0.2
522	0.23
523	0.23
524	0.29
525	0.33
526	0.37
527	0.43
528	0.41
529	0.38
530	0.36
531	0.39
532	0.33
533	0.36
534	0.35
535	0.3
536	0.31
537	0.34
538	0.36
539	0.31
540	0.31
541	0.25
542	0.21
543	0.23
544	0.21
545	0.16
546	0.12
547	0.11
548	0.11
549	0.1
550	0.09
551	0.06
552	0.05
553	0.05
554	0.05
555	0.06
556	0.08
557	0.07
558	0.08
559	0.08
560	0.09
561	0.11
562	0.14
563	0.16
564	0.15
565	0.17
566	0.17
567	0.17
568	0.17
569	0.17
570	0.14
571	0.12
572	0.12
573	0.11
574	0.12
575	0.17
576	0.21
577	0.22
578	0.25
579	0.29
580	0.34
581	0.39
582	0.42
583	0.39
584	0.39
585	0.44
586	0.44
587	0.4
588	0.36
589	0.31
590	0.29
591	0.28
592	0.25
593	0.21
594	0.22
595	0.25
596	0.25
597	0.25

J8PIT5

3D AlphaFold-predicted Structure Viewer