Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4X157

Protein Details
Accession A0A4Q4X157    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-60AVLRQMRKFHWKRKHLNASLNIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, mito 6, plas 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR013698  Squalene_epoxidase  
IPR040125  Squalene_monox  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0050660  F:flavin adenine dinucleotide binding  
GO:0004506  F:squalene monooxygenase activity  
GO:0016126  P:sterol biosynthetic process  
Pfam View protein in Pfam  
PF08491  SE  
Amino Acid Sequences MNMRHPLTGGGMTVGLNDVVVLQDLLGPHKIPDLEDDGAVLRQMRKFHWKRKHLNASLNILAQALYLLFVADDPKLQVLRQGFIEYIKQGSNYVEEPSGLMGGVFHSPFLLCYHFAAIAVHSLGILLRDSYARSAWALPVAIVQCIRVIFAAGQLIAPYILAELRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.06
4 0.06
5 0.05
6 0.04
7 0.05
8 0.04
9 0.04
10 0.05
11 0.06
12 0.08
13 0.09
14 0.09
15 0.09
16 0.12
17 0.12
18 0.11
19 0.14
20 0.17
21 0.17
22 0.16
23 0.17
24 0.15
25 0.15
26 0.15
27 0.14
28 0.11
29 0.13
30 0.14
31 0.17
32 0.27
33 0.35
34 0.45
35 0.54
36 0.61
37 0.68
38 0.77
39 0.85
40 0.81
41 0.81
42 0.76
43 0.72
44 0.64
45 0.55
46 0.44
47 0.33
48 0.27
49 0.18
50 0.13
51 0.06
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.06
64 0.09
65 0.09
66 0.1
67 0.11
68 0.11
69 0.1
70 0.11
71 0.12
72 0.09
73 0.1
74 0.09
75 0.08
76 0.08
77 0.09
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.09
84 0.08
85 0.08
86 0.06
87 0.05
88 0.03
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.08
98 0.08
99 0.08
100 0.1
101 0.1
102 0.1
103 0.1
104 0.09
105 0.09
106 0.08
107 0.07
108 0.06
109 0.06
110 0.05
111 0.06
112 0.06
113 0.04
114 0.05
115 0.06
116 0.07
117 0.08
118 0.09
119 0.09
120 0.1
121 0.11
122 0.11
123 0.13
124 0.12
125 0.11
126 0.14
127 0.14
128 0.14
129 0.13
130 0.12
131 0.12
132 0.12
133 0.12
134 0.09
135 0.09
136 0.08
137 0.1
138 0.11
139 0.1
140 0.1
141 0.09
142 0.1
143 0.08
144 0.08
145 0.06
146 0.05