Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XTQ2

Protein Details
Accession A0A4Q4XTQ2   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-33QDTSAKRSNSRTRTPRPTTPLRPSSRHydrophilic
NLS Segment(s)
PositionSequence
176-209LPPPSRGGASSRGRAGTGRSRPSGLAKPRARGIR
Subcellular Location(s) nucl 12, cyto_nucl 10, mito 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013962  DASH_Dam1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0008608  P:attachment of spindle microtubules to kinetochore  
Pfam View protein in Pfam  
PF08653  DASH_Dam1  
Amino Acid Sequences MSASESAQDTSAKRSNSRTRTPRPTTPLRPSSRSSFRDSARRSVEGGGEPFPLNAFEPAFAELSDAVADLEANMMHFQLMHESLARFSESFASFLYGLNMNAFCVDFPEGPIAESFRRAKQNEEHAGSTQPTGRAGEFDGETTFMTTDTSFVENPLPASKPTPKKFATSDTRQSRLPPPSRGGASSRGRAGTGRSRPSGLAKPRARGIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.47
3 0.53
4 0.62
5 0.65
6 0.7
7 0.78
8 0.83
9 0.82
10 0.8
11 0.82
12 0.81
13 0.81
14 0.81
15 0.77
16 0.74
17 0.7
18 0.7
19 0.7
20 0.64
21 0.62
22 0.59
23 0.57
24 0.62
25 0.61
26 0.61
27 0.56
28 0.54
29 0.48
30 0.43
31 0.41
32 0.34
33 0.32
34 0.25
35 0.22
36 0.2
37 0.19
38 0.17
39 0.14
40 0.12
41 0.11
42 0.1
43 0.08
44 0.09
45 0.1
46 0.1
47 0.09
48 0.09
49 0.08
50 0.08
51 0.07
52 0.06
53 0.05
54 0.04
55 0.04
56 0.03
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.09
72 0.1
73 0.08
74 0.07
75 0.11
76 0.11
77 0.11
78 0.11
79 0.12
80 0.11
81 0.11
82 0.12
83 0.09
84 0.08
85 0.08
86 0.08
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.07
93 0.06
94 0.06
95 0.08
96 0.08
97 0.08
98 0.08
99 0.09
100 0.08
101 0.12
102 0.13
103 0.16
104 0.23
105 0.23
106 0.27
107 0.31
108 0.4
109 0.43
110 0.44
111 0.42
112 0.36
113 0.37
114 0.34
115 0.29
116 0.22
117 0.16
118 0.14
119 0.13
120 0.12
121 0.11
122 0.11
123 0.12
124 0.1
125 0.11
126 0.1
127 0.1
128 0.1
129 0.09
130 0.09
131 0.06
132 0.07
133 0.06
134 0.06
135 0.07
136 0.09
137 0.09
138 0.1
139 0.11
140 0.11
141 0.12
142 0.14
143 0.14
144 0.13
145 0.18
146 0.26
147 0.34
148 0.38
149 0.45
150 0.44
151 0.47
152 0.5
153 0.54
154 0.54
155 0.53
156 0.6
157 0.6
158 0.61
159 0.58
160 0.58
161 0.57
162 0.58
163 0.56
164 0.52
165 0.48
166 0.52
167 0.53
168 0.52
169 0.47
170 0.46
171 0.46
172 0.45
173 0.44
174 0.38
175 0.37
176 0.35
177 0.37
178 0.38
179 0.41
180 0.43
181 0.42
182 0.43
183 0.44
184 0.5
185 0.53
186 0.52
187 0.54
188 0.53
189 0.56