Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XPN2

Protein Details
Accession A0A4Q4XPN2   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
265-292PPAGWKKTTFDRRMRAKRRRAWWTIQGVHydrophilic
NLS Segment(s)
PositionSequence
276-284RRMRAKRRR
Subcellular Location(s) plas 19, mito 3, nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039960  MCP1  
IPR012472  MCP1_TM  
Gene Ontology GO:0016020  C:membrane  
GO:0055088  P:lipid homeostasis  
Pfam View protein in Pfam  
PF07950  MCP1_TM  
Amino Acid Sequences MDSPWLKRQGSQETLVSLLELDPTPMESEDDLSRQLGGSTIKSQNSTSSSLGLSGSGHGAIYYLTRIQRYSSYTFTFFAGLHITNTSLIPLIYRSVPYSEPFLVMARELYQTPLTEPLLVGLPVLAHVSSGIALRLVRRHQNRKRYGEHKGSALPLPSISSSSGSNGGRRLPSPWPSFNNISISGYLFATVFAAHVAMNRVLPLLVEGDSSNVGLQYVAHGFARHANAHAPGLLRVQGWAAYAALLSLGVGHMVWGWAKWLGVAPPAGWKKTTFDRRMRAKRRRAWWTIQGVVVAVAGLWAAGGLGIVARAGAAEGWLGGVYDGIYSWAWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.29
4 0.2
5 0.15
6 0.13
7 0.11
8 0.1
9 0.09
10 0.1
11 0.11
12 0.11
13 0.12
14 0.1
15 0.13
16 0.15
17 0.16
18 0.16
19 0.15
20 0.15
21 0.14
22 0.13
23 0.13
24 0.13
25 0.14
26 0.2
27 0.25
28 0.27
29 0.28
30 0.29
31 0.31
32 0.32
33 0.33
34 0.28
35 0.24
36 0.23
37 0.22
38 0.21
39 0.17
40 0.14
41 0.11
42 0.1
43 0.08
44 0.08
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.1
51 0.12
52 0.13
53 0.14
54 0.16
55 0.19
56 0.24
57 0.27
58 0.28
59 0.3
60 0.31
61 0.31
62 0.3
63 0.27
64 0.22
65 0.19
66 0.17
67 0.14
68 0.13
69 0.12
70 0.12
71 0.11
72 0.11
73 0.1
74 0.08
75 0.07
76 0.07
77 0.07
78 0.08
79 0.08
80 0.09
81 0.1
82 0.12
83 0.13
84 0.14
85 0.18
86 0.17
87 0.16
88 0.16
89 0.16
90 0.14
91 0.13
92 0.12
93 0.09
94 0.1
95 0.09
96 0.11
97 0.11
98 0.11
99 0.11
100 0.14
101 0.13
102 0.12
103 0.12
104 0.1
105 0.1
106 0.1
107 0.09
108 0.06
109 0.05
110 0.05
111 0.05
112 0.04
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.1
123 0.13
124 0.2
125 0.29
126 0.4
127 0.47
128 0.57
129 0.65
130 0.69
131 0.74
132 0.72
133 0.73
134 0.71
135 0.65
136 0.57
137 0.5
138 0.45
139 0.38
140 0.33
141 0.24
142 0.15
143 0.14
144 0.11
145 0.1
146 0.08
147 0.08
148 0.08
149 0.08
150 0.13
151 0.12
152 0.14
153 0.14
154 0.15
155 0.15
156 0.15
157 0.17
158 0.17
159 0.23
160 0.27
161 0.3
162 0.31
163 0.35
164 0.37
165 0.36
166 0.34
167 0.28
168 0.25
169 0.21
170 0.19
171 0.15
172 0.12
173 0.11
174 0.08
175 0.07
176 0.06
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.05
183 0.06
184 0.06
185 0.06
186 0.07
187 0.07
188 0.06
189 0.06
190 0.06
191 0.05
192 0.05
193 0.06
194 0.06
195 0.06
196 0.07
197 0.07
198 0.06
199 0.05
200 0.05
201 0.04
202 0.04
203 0.05
204 0.06
205 0.06
206 0.07
207 0.07
208 0.08
209 0.12
210 0.15
211 0.14
212 0.14
213 0.15
214 0.16
215 0.16
216 0.17
217 0.14
218 0.12
219 0.13
220 0.13
221 0.12
222 0.1
223 0.1
224 0.09
225 0.09
226 0.09
227 0.07
228 0.06
229 0.06
230 0.05
231 0.05
232 0.04
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.04
242 0.04
243 0.05
244 0.06
245 0.06
246 0.06
247 0.08
248 0.08
249 0.1
250 0.11
251 0.1
252 0.19
253 0.23
254 0.23
255 0.23
256 0.23
257 0.26
258 0.35
259 0.45
260 0.45
261 0.51
262 0.59
263 0.69
264 0.8
265 0.86
266 0.86
267 0.87
268 0.87
269 0.88
270 0.88
271 0.85
272 0.82
273 0.81
274 0.79
275 0.72
276 0.64
277 0.54
278 0.44
279 0.37
280 0.28
281 0.18
282 0.1
283 0.06
284 0.04
285 0.03
286 0.02
287 0.02
288 0.02
289 0.02
290 0.02
291 0.02
292 0.02
293 0.02
294 0.03
295 0.03
296 0.02
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.04
303 0.04
304 0.04
305 0.05
306 0.04
307 0.05
308 0.04
309 0.04
310 0.05
311 0.06