FuNGI

J8LLL9

Protein Details

Accession

J8LLL9

Localization Confidence

Medium

Confidence Score

14.5

NoLS Segment(s)

Position	Sequence	Protein Nature
7-42	ENTGSQYASKKPKTRRNVHPFKRDVRAKKVIRFNAT	Hydrophilic

NLS Segment(s)

Position	Sequence
16-35	KKPKTRRNVHPFKRDVRAKK

Subcellular Location(s)

nucl 25.5, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR011709 DEAD-box_helicase_OB_fold IPR011545 DEAD/DEAH_box_helicase_dom IPR002464 DNA/RNA_helicase_DEAH_CS IPR007502 Helicase-assoc_dom IPR014001 Helicase_ATP-bd IPR001650 Helicase_C IPR027417 P-loop_NTPase
Gene Ontology	GO:0043231 C:intracellular membrane-bounded organelle GO:1990904 C:ribonucleoprotein complex GO:0005524 F:ATP binding GO:0008186 F:ATP-dependent activity, acting on RNA GO:0004386 F:helicase activity GO:0016787 F:hydrolase activity GO:0003676 F:nucleic acid binding GO:0022613 P:ribonucleoprotein complex biogenesis GO:0006396 P:RNA processing
Pfam	View protein in Pfam PF00270 DEAD PF04408 HA2 PF00271 Helicase_C PF07717 OB_NTP_bind
PROSITE	View protein in PROSITE PS00690 DEAH_ATP_HELICASE PS51192 HELICASE_ATP_BIND_1 PS51194 HELICASE_CTER
CDD	cd17917 DEXHc_RHA-like cd18791 SF2_C_RHA

Amino Acid Sequences

MTANNNENTGSQYASKKPKTRRNVHPFKRDVRAKKVIRFNATEEDDHALYERLRTGNTATYKSLKSQADDLLKVRKTLPVFQHKREIMTYIESNPVTVLIGETGSGKSTQIPQFILEQLYDKKKHGSIAVTQPRRVAAINLATRVAQEHGSKLGDQVGYSVRFDNTTTARTRLKYLTDGMLLRELMMNSDLKEYSVVIIDEAHERTVLTDLILGFLKSLMQGTRPDLRIVVMSATLQAEKFSEFFDNAPILFVEGRKFDVTQYYLKAPTDDIVDAVIRCCMQINQGEQLGDILCFLPGQEEIDKAVAIMEKIAKYVSEESPVPLIVPYPLYAALPPMQQALVFAPIKGFKRKVVFSTNIAETSVTISGVKFIVDSGLRKVKVWRHQLGLATLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDYLKLPKQSEPEIARSDVTSPVLMLKRYGIDDIVNWTWFENPGKEAIVMGLQELYELGALDNRGKITKRGEQMALLPLQPHLSSVLIKASEVGCLSQVIDIISCLSVENLLLNPSPEERDDINERRLSLCNAGKRYGDLIMLKELFDIYFYELGKSQDANSERNDWCKELCISLRGFKNVVRVRDQLRVYCKRLFSSINEENEETRKIGEDSDEISKILKCFLTGFIKNTAIGMPDRSYRTVSTGEPISVHPSSMLFLNKSCPGIMYTEYVFTTKGYARNVSRIELSWLQEVVTNGTAVAKQKITSSK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.42
2	0.5
3	0.55
4	0.64
5	0.72
6	0.79
7	0.84
8	0.86
9	0.87
10	0.9
11	0.92
12	0.92
13	0.91
14	0.88
15	0.88
16	0.87
17	0.84
18	0.82
19	0.82
20	0.8
21	0.8
22	0.82
23	0.8
24	0.77
25	0.73
26	0.68
27	0.67
28	0.63
29	0.54
30	0.46
31	0.43
32	0.36
33	0.32
34	0.28
35	0.2
36	0.17
37	0.18
38	0.2
39	0.17
40	0.17
41	0.19
42	0.2
43	0.26
44	0.3
45	0.32
46	0.31
47	0.36
48	0.37
49	0.39
50	0.45
51	0.39
52	0.37
53	0.38
54	0.42
55	0.43
56	0.44
57	0.44
58	0.45
59	0.44
60	0.42
61	0.39
62	0.37
63	0.34
64	0.38
65	0.45
66	0.47
67	0.53
68	0.56
69	0.66
70	0.62
71	0.62
72	0.56
73	0.48
74	0.4
75	0.38
76	0.36
77	0.28
78	0.32
79	0.28
80	0.27
81	0.24
82	0.22
83	0.16
84	0.13
85	0.12
86	0.06
87	0.06
88	0.06
89	0.08
90	0.08
91	0.08
92	0.09
93	0.08
94	0.1
95	0.18
96	0.21
97	0.23
98	0.23
99	0.24
100	0.27
101	0.28
102	0.27
103	0.2
104	0.21
105	0.24
106	0.31
107	0.32
108	0.31
109	0.33
110	0.34
111	0.37
112	0.37
113	0.34
114	0.34
115	0.43
116	0.52
117	0.52
118	0.52
119	0.5
120	0.47
121	0.44
122	0.37
123	0.28
124	0.23
125	0.26
126	0.28
127	0.28
128	0.28
129	0.26
130	0.25
131	0.25
132	0.21
133	0.16
134	0.14
135	0.14
136	0.17
137	0.18
138	0.18
139	0.17
140	0.2
141	0.17
142	0.16
143	0.16
144	0.18
145	0.18
146	0.19
147	0.2
148	0.16
149	0.16
150	0.17
151	0.2
152	0.17
153	0.2
154	0.22
155	0.25
156	0.29
157	0.29
158	0.33
159	0.32
160	0.33
161	0.32
162	0.32
163	0.31
164	0.3
165	0.3
166	0.26
167	0.25
168	0.22
169	0.19
170	0.18
171	0.14
172	0.12
173	0.12
174	0.12
175	0.1
176	0.12
177	0.12
178	0.1
179	0.11
180	0.1
181	0.1
182	0.11
183	0.1
184	0.07
185	0.08
186	0.09
187	0.11
188	0.12
189	0.11
190	0.09
191	0.09
192	0.1
193	0.11
194	0.1
195	0.07
196	0.08
197	0.08
198	0.09
199	0.1
200	0.09
201	0.07
202	0.07
203	0.07
204	0.06
205	0.07
206	0.06
207	0.08
208	0.1
209	0.14
210	0.2
211	0.21
212	0.22
213	0.21
214	0.21
215	0.2
216	0.18
217	0.15
218	0.09
219	0.08
220	0.09
221	0.09
222	0.09
223	0.08
224	0.08
225	0.07
226	0.08
227	0.08
228	0.08
229	0.09
230	0.09
231	0.09
232	0.11
233	0.11
234	0.11
235	0.11
236	0.09
237	0.09
238	0.09
239	0.09
240	0.09
241	0.09
242	0.11
243	0.11
244	0.11
245	0.11
246	0.15
247	0.16
248	0.18
249	0.19
250	0.2
251	0.21
252	0.21
253	0.21
254	0.17
255	0.16
256	0.15
257	0.13
258	0.1
259	0.09
260	0.1
261	0.09
262	0.09
263	0.09
264	0.06
265	0.06
266	0.07
267	0.06
268	0.08
269	0.12
270	0.14
271	0.15
272	0.17
273	0.17
274	0.16
275	0.16
276	0.14
277	0.1
278	0.08
279	0.06
280	0.04
281	0.04
282	0.04
283	0.04
284	0.04
285	0.06
286	0.06
287	0.07
288	0.08
289	0.08
290	0.08
291	0.07
292	0.08
293	0.06
294	0.06
295	0.06
296	0.08
297	0.07
298	0.08
299	0.08
300	0.07
301	0.09
302	0.12
303	0.12
304	0.13
305	0.13
306	0.13
307	0.14
308	0.14
309	0.12
310	0.09
311	0.08
312	0.06
313	0.06
314	0.06
315	0.06
316	0.06
317	0.06
318	0.06
319	0.07
320	0.08
321	0.08
322	0.08
323	0.07
324	0.07
325	0.07
326	0.07
327	0.07
328	0.1
329	0.1
330	0.1
331	0.1
332	0.14
333	0.16
334	0.19
335	0.2
336	0.19
337	0.23
338	0.25
339	0.28
340	0.3
341	0.31
342	0.3
343	0.33
344	0.3
345	0.26
346	0.25
347	0.21
348	0.15
349	0.14
350	0.11
351	0.07
352	0.06
353	0.05
354	0.06
355	0.06
356	0.06
357	0.04
358	0.04
359	0.05
360	0.06
361	0.07
362	0.1
363	0.15
364	0.15
365	0.16
366	0.2
367	0.25
368	0.33
369	0.4
370	0.4
371	0.38
372	0.4
373	0.41
374	0.38
375	0.34
376	0.25
377	0.18
378	0.14
379	0.11
380	0.08
381	0.07
382	0.06
383	0.04
384	0.04
385	0.03
386	0.05
387	0.06
388	0.08
389	0.09
390	0.1
391	0.1
392	0.12
393	0.15
394	0.15
395	0.15
396	0.15
397	0.15
398	0.23
399	0.24
400	0.28
401	0.28
402	0.27
403	0.27
404	0.27
405	0.26
406	0.23
407	0.22
408	0.17
409	0.2
410	0.21
411	0.22
412	0.24
413	0.27
414	0.26
415	0.29
416	0.3
417	0.27
418	0.28
419	0.29
420	0.33
421	0.32
422	0.33
423	0.32
424	0.31
425	0.28
426	0.25
427	0.24
428	0.19
429	0.16
430	0.11
431	0.09
432	0.12
433	0.14
434	0.13
435	0.12
436	0.12
437	0.13
438	0.13
439	0.14
440	0.1
441	0.09
442	0.09
443	0.14
444	0.14
445	0.13
446	0.12
447	0.12
448	0.12
449	0.13
450	0.14
451	0.11
452	0.1
453	0.11
454	0.12
455	0.12
456	0.11
457	0.09
458	0.09
459	0.08
460	0.07
461	0.06
462	0.05
463	0.05
464	0.05
465	0.05
466	0.03
467	0.04
468	0.04
469	0.05
470	0.05
471	0.06
472	0.08
473	0.08
474	0.11
475	0.11
476	0.15
477	0.19
478	0.26
479	0.29
480	0.32
481	0.32
482	0.31
483	0.33
484	0.34
485	0.29
486	0.23
487	0.19
488	0.16
489	0.16
490	0.14
491	0.12
492	0.09
493	0.08
494	0.09
495	0.09
496	0.12
497	0.11
498	0.11
499	0.12
500	0.11
501	0.11
502	0.11
503	0.1
504	0.08
505	0.08
506	0.09
507	0.07
508	0.08
509	0.06
510	0.06
511	0.06
512	0.06
513	0.06
514	0.06
515	0.05
516	0.05
517	0.05
518	0.05
519	0.05
520	0.05
521	0.07
522	0.07
523	0.07
524	0.08
525	0.09
526	0.11
527	0.11
528	0.14
529	0.13
530	0.18
531	0.25
532	0.29
533	0.34
534	0.34
535	0.34
536	0.34
537	0.35
538	0.32
539	0.32
540	0.33
541	0.34
542	0.35
543	0.37
544	0.35
545	0.34
546	0.34
547	0.28
548	0.26
549	0.21
550	0.19
551	0.22
552	0.22
553	0.2
554	0.18
555	0.17
556	0.14
557	0.12
558	0.12
559	0.09
560	0.12
561	0.12
562	0.13
563	0.15
564	0.16
565	0.17
566	0.17
567	0.15
568	0.19
569	0.21
570	0.22
571	0.23
572	0.3
573	0.29
574	0.35
575	0.37
576	0.32
577	0.3
578	0.31
579	0.3
580	0.27
581	0.28
582	0.26
583	0.26
584	0.32
585	0.35
586	0.33
587	0.34
588	0.31
589	0.39
590	0.4
591	0.42
592	0.4
593	0.41
594	0.43
595	0.49
596	0.5
597	0.46
598	0.51
599	0.55
600	0.54
601	0.55
602	0.53
603	0.48
604	0.49
605	0.46
606	0.41
607	0.43
608	0.45
609	0.44
610	0.45
611	0.44
612	0.42
613	0.42
614	0.39
615	0.3
616	0.23
617	0.2
618	0.17
619	0.17
620	0.17
621	0.16
622	0.17
623	0.21
624	0.22
625	0.2
626	0.21
627	0.22
628	0.2
629	0.21
630	0.18
631	0.14
632	0.15
633	0.21
634	0.27
635	0.28
636	0.31
637	0.33
638	0.34
639	0.34
640	0.33
641	0.27
642	0.21
643	0.2
644	0.2
645	0.17
646	0.21
647	0.25
648	0.26
649	0.28
650	0.27
651	0.29
652	0.29
653	0.27
654	0.27
655	0.26
656	0.25
657	0.24
658	0.24
659	0.27
660	0.24
661	0.23
662	0.18
663	0.16
664	0.16
665	0.18
666	0.21
667	0.16
668	0.17
669	0.22
670	0.24
671	0.25
672	0.24
673	0.22
674	0.19
675	0.21
676	0.22
677	0.21
678	0.19
679	0.2
680	0.21
681	0.21
682	0.2
683	0.17
684	0.19
685	0.19
686	0.23
687	0.24
688	0.31
689	0.34
690	0.42
691	0.44
692	0.43
693	0.42
694	0.38
695	0.41
696	0.39
697	0.38
698	0.33
699	0.31
700	0.28
701	0.28
702	0.28
703	0.24
704	0.2
705	0.17
706	0.14
707	0.15
708	0.17
709	0.17
710	0.21
711	0.19
712	0.18

J8LLL9

3D AlphaFold-predicted Structure Viewer