Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XKL7

Protein Details
Accession A0A4Q4XKL7   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-50VPAEQHQRPSRQQRRAGRRRRGNRGTARNGTVHydrophilic
NLS Segment(s)
PositionSequence
28-43SRQQRRAGRRRRGNRG
Subcellular Location(s) mito 9, cyto_nucl 7.5, nucl 7, cyto 6, extr 4
Family & Domain DBs
Amino Acid Sequences MSSPNYSNVSGFLSSPPAVPAEQHQRPSRQQRRAGRRRRGNRGTARNGTVQQQLELQGVIVHRLDAISNQLGVLIDRIAPEFFDGRSTTIGRASPIANTASRNCSATLEPYPMYQGRPTPPAGRASPSGPQQPDNLPFDIPGYTRERPAGGSEPSPVGRAAAPPSTPESLLRRRALTVAVLETDLAETRRQLRDLRAVARYGSAVMAADAVEALASGLEISIEQGLDRLRSLQHEEAQQQWTTAGLAASTRLARAQPPTPAQVQAPFAPCPSHPGHRRYAASYLTPGCAGAVSPTGSEVGLDDWTYEYVDPEPDWAVVDARQAAATPETFPVGFAFHGGHETALPYRRRFVSPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.17
5 0.16
6 0.16
7 0.22
8 0.28
9 0.33
10 0.4
11 0.45
12 0.51
13 0.6
14 0.71
15 0.73
16 0.73
17 0.76
18 0.8
19 0.85
20 0.89
21 0.9
22 0.9
23 0.91
24 0.91
25 0.93
26 0.91
27 0.9
28 0.9
29 0.9
30 0.88
31 0.85
32 0.78
33 0.73
34 0.66
35 0.59
36 0.55
37 0.45
38 0.37
39 0.32
40 0.29
41 0.24
42 0.22
43 0.18
44 0.13
45 0.12
46 0.13
47 0.11
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.11
54 0.11
55 0.1
56 0.1
57 0.11
58 0.11
59 0.11
60 0.11
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.09
68 0.1
69 0.09
70 0.11
71 0.11
72 0.12
73 0.15
74 0.16
75 0.15
76 0.17
77 0.18
78 0.16
79 0.17
80 0.16
81 0.14
82 0.15
83 0.17
84 0.15
85 0.17
86 0.19
87 0.21
88 0.21
89 0.22
90 0.2
91 0.2
92 0.2
93 0.21
94 0.21
95 0.2
96 0.19
97 0.18
98 0.21
99 0.2
100 0.21
101 0.18
102 0.2
103 0.2
104 0.23
105 0.25
106 0.25
107 0.27
108 0.3
109 0.3
110 0.29
111 0.27
112 0.27
113 0.29
114 0.29
115 0.32
116 0.29
117 0.29
118 0.28
119 0.3
120 0.32
121 0.31
122 0.28
123 0.22
124 0.21
125 0.2
126 0.19
127 0.15
128 0.14
129 0.17
130 0.17
131 0.18
132 0.18
133 0.18
134 0.18
135 0.2
136 0.21
137 0.16
138 0.16
139 0.17
140 0.18
141 0.17
142 0.18
143 0.14
144 0.11
145 0.1
146 0.1
147 0.11
148 0.11
149 0.11
150 0.11
151 0.14
152 0.14
153 0.14
154 0.15
155 0.18
156 0.23
157 0.29
158 0.29
159 0.27
160 0.27
161 0.27
162 0.26
163 0.21
164 0.16
165 0.11
166 0.09
167 0.09
168 0.08
169 0.07
170 0.07
171 0.06
172 0.06
173 0.05
174 0.06
175 0.1
176 0.12
177 0.13
178 0.15
179 0.17
180 0.24
181 0.28
182 0.31
183 0.29
184 0.28
185 0.27
186 0.26
187 0.23
188 0.15
189 0.12
190 0.08
191 0.06
192 0.05
193 0.05
194 0.04
195 0.04
196 0.03
197 0.03
198 0.02
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.03
208 0.03
209 0.03
210 0.03
211 0.04
212 0.05
213 0.06
214 0.06
215 0.07
216 0.07
217 0.1
218 0.15
219 0.17
220 0.2
221 0.24
222 0.25
223 0.28
224 0.3
225 0.28
226 0.24
227 0.2
228 0.17
229 0.13
230 0.12
231 0.08
232 0.05
233 0.05
234 0.06
235 0.07
236 0.07
237 0.07
238 0.08
239 0.08
240 0.1
241 0.15
242 0.17
243 0.21
244 0.24
245 0.28
246 0.28
247 0.3
248 0.29
249 0.28
250 0.28
251 0.26
252 0.26
253 0.23
254 0.22
255 0.22
256 0.21
257 0.23
258 0.24
259 0.3
260 0.34
261 0.38
262 0.44
263 0.5
264 0.53
265 0.5
266 0.51
267 0.45
268 0.4
269 0.4
270 0.35
271 0.29
272 0.26
273 0.23
274 0.17
275 0.14
276 0.12
277 0.09
278 0.09
279 0.08
280 0.08
281 0.09
282 0.09
283 0.09
284 0.09
285 0.08
286 0.07
287 0.07
288 0.07
289 0.07
290 0.08
291 0.09
292 0.1
293 0.09
294 0.09
295 0.09
296 0.11
297 0.11
298 0.12
299 0.12
300 0.11
301 0.13
302 0.12
303 0.12
304 0.11
305 0.14
306 0.13
307 0.13
308 0.13
309 0.12
310 0.13
311 0.14
312 0.14
313 0.13
314 0.13
315 0.14
316 0.14
317 0.14
318 0.14
319 0.13
320 0.12
321 0.11
322 0.11
323 0.1
324 0.12
325 0.11
326 0.11
327 0.1
328 0.12
329 0.16
330 0.23
331 0.28
332 0.28
333 0.35
334 0.38
335 0.41