Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P6XFI6

Protein Details
Accession A0A4P6XFI6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-38TSTSPQQPVRCEKKRGRRQVHHKDRKNINTTMHydrophilic
NLS Segment(s)
PositionSequence
20-24KRGRR
Subcellular Location(s) nucl 14.5, mito_nucl 11.666, cyto_nucl 10.833, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012621  Tom7  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0030150  P:protein import into mitochondrial matrix  
Pfam View protein in Pfam  
PF08038  Tom7  
Amino Acid Sequences MDRDPDTSTSPQQPVRCEKKRGRRQVHHKDRKNINTTMATTYQLALSDESKERILKVMSYSRTIAHYGFIPFILYLGWKSTPSKPSLFNLLSPFPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.6
4 0.63
5 0.68
6 0.74
7 0.81
8 0.86
9 0.86
10 0.87
11 0.9
12 0.92
13 0.94
14 0.94
15 0.92
16 0.91
17 0.9
18 0.88
19 0.82
20 0.73
21 0.66
22 0.58
23 0.51
24 0.45
25 0.36
26 0.28
27 0.23
28 0.21
29 0.16
30 0.13
31 0.12
32 0.09
33 0.08
34 0.09
35 0.09
36 0.1
37 0.11
38 0.11
39 0.11
40 0.12
41 0.12
42 0.1
43 0.14
44 0.19
45 0.2
46 0.22
47 0.23
48 0.22
49 0.23
50 0.23
51 0.2
52 0.15
53 0.15
54 0.14
55 0.13
56 0.12
57 0.11
58 0.09
59 0.09
60 0.08
61 0.07
62 0.06
63 0.08
64 0.1
65 0.11
66 0.15
67 0.21
68 0.26
69 0.29
70 0.32
71 0.34
72 0.36
73 0.44
74 0.42
75 0.4
76 0.4
77 0.4