Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XSI0

Protein Details
Accession A0A4P6XSI0    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSLRSKPKLRAKSIKRQGEFHydrophilic
70-92GNMKTALKRRIKAKKSRSKKLKFBasic
NLS Segment(s)
PositionSequence
7-15SKPKLRAKS
76-92LKRRIKAKKSRSKKLKF
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKPKLRAKSIKRQGEFNQFVDDRNARLAEKARLNLLKQNEEKMAQDTPIEEASEEATKSAPTTGNMKTALKRRIKAKKSRSKKLKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.87
4 0.78
5 0.76
6 0.73
7 0.73
8 0.68
9 0.59
10 0.56
11 0.46
12 0.45
13 0.43
14 0.37
15 0.27
16 0.24
17 0.24
18 0.16
19 0.19
20 0.21
21 0.21
22 0.24
23 0.24
24 0.26
25 0.27
26 0.28
27 0.3
28 0.29
29 0.31
30 0.28
31 0.3
32 0.27
33 0.25
34 0.25
35 0.23
36 0.2
37 0.14
38 0.13
39 0.11
40 0.11
41 0.11
42 0.1
43 0.08
44 0.07
45 0.09
46 0.1
47 0.09
48 0.08
49 0.07
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.14
56 0.16
57 0.2
58 0.22
59 0.25
60 0.28
61 0.36
62 0.43
63 0.47
64 0.5
65 0.56
66 0.65
67 0.72
68 0.77
69 0.8
70 0.82
71 0.85
72 0.91