Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P6XJY1

Protein Details
Accession A0A4P6XJY1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ARNLRRLKFKGGKIFRRLKAKLBasic
129-148NELARRKISRRPSPARHLVKHydrophilic
NLS Segment(s)
PositionSequence
12-26RRLKFKGGKIFRRLK
133-150RRKISRRPSPARHLVKPK
Subcellular Location(s) mito 14, cyto 7, plas 2, nucl 1, extr 1, pero 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKVLIAFARNLRRLKFKGGKIFRRLKAKLSSCGSTGADFPKVPHTSCASIEKVGLELLGLDYFQQPAEHQALPPAYEECVCSKPPALITPATNIATYERGEKQISIAPTVPLELARGRSPQVLYRSQLNELARRKISRRPSPARHLVKPKPGFGAVDDLVALRLQRYALSWWGHVAFLRASMLLVLVMTSLFWILGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.6
4 0.64
5 0.71
6 0.76
7 0.77
8 0.84
9 0.8
10 0.81
11 0.75
12 0.72
13 0.71
14 0.67
15 0.66
16 0.62
17 0.57
18 0.48
19 0.5
20 0.43
21 0.34
22 0.31
23 0.25
24 0.23
25 0.2
26 0.21
27 0.25
28 0.26
29 0.26
30 0.27
31 0.28
32 0.28
33 0.3
34 0.34
35 0.27
36 0.26
37 0.26
38 0.23
39 0.19
40 0.16
41 0.13
42 0.08
43 0.06
44 0.05
45 0.05
46 0.04
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.05
53 0.09
54 0.12
55 0.12
56 0.12
57 0.15
58 0.15
59 0.15
60 0.16
61 0.13
62 0.1
63 0.1
64 0.11
65 0.11
66 0.13
67 0.13
68 0.13
69 0.13
70 0.13
71 0.14
72 0.15
73 0.14
74 0.13
75 0.14
76 0.15
77 0.17
78 0.17
79 0.16
80 0.14
81 0.13
82 0.13
83 0.12
84 0.13
85 0.11
86 0.13
87 0.13
88 0.13
89 0.14
90 0.15
91 0.15
92 0.14
93 0.14
94 0.12
95 0.12
96 0.12
97 0.11
98 0.07
99 0.08
100 0.07
101 0.09
102 0.1
103 0.11
104 0.11
105 0.14
106 0.14
107 0.18
108 0.22
109 0.23
110 0.24
111 0.29
112 0.3
113 0.29
114 0.33
115 0.3
116 0.33
117 0.33
118 0.37
119 0.35
120 0.36
121 0.37
122 0.41
123 0.49
124 0.51
125 0.57
126 0.61
127 0.66
128 0.72
129 0.8
130 0.8
131 0.78
132 0.78
133 0.75
134 0.76
135 0.72
136 0.65
137 0.59
138 0.52
139 0.45
140 0.36
141 0.36
142 0.26
143 0.22
144 0.19
145 0.15
146 0.14
147 0.14
148 0.12
149 0.06
150 0.06
151 0.06
152 0.07
153 0.08
154 0.11
155 0.16
156 0.18
157 0.18
158 0.21
159 0.21
160 0.21
161 0.2
162 0.2
163 0.14
164 0.14
165 0.14
166 0.11
167 0.1
168 0.1
169 0.09
170 0.07
171 0.06
172 0.05
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04