Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XES4

Protein Details
Accession A0A4P6XES4   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
21-46SGGVLKSALRRRKRKEKEQLKPKMDDBasic
NLS Segment(s)
PositionSequence
28-41ALRRRKRKEKEQLK
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MQAKTNSFNERLAQKATFNLSGGVLKSALRRRKRKEKEQLKPKMDDLLSSLPASTVNVVDASSLKKKEFVKATSAKPSNMPNPQKHSGHTKLLEAENQHFSRVLQDRLFQQSPFAALKQAIALKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.29
5 0.25
6 0.23
7 0.2
8 0.2
9 0.19
10 0.16
11 0.12
12 0.12
13 0.18
14 0.25
15 0.33
16 0.41
17 0.5
18 0.59
19 0.69
20 0.78
21 0.83
22 0.86
23 0.89
24 0.9
25 0.91
26 0.92
27 0.86
28 0.8
29 0.7
30 0.66
31 0.54
32 0.44
33 0.37
34 0.3
35 0.26
36 0.22
37 0.21
38 0.14
39 0.14
40 0.13
41 0.09
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.08
49 0.11
50 0.12
51 0.12
52 0.16
53 0.17
54 0.23
55 0.27
56 0.27
57 0.31
58 0.36
59 0.4
60 0.44
61 0.45
62 0.41
63 0.38
64 0.41
65 0.39
66 0.43
67 0.46
68 0.42
69 0.48
70 0.53
71 0.52
72 0.5
73 0.53
74 0.48
75 0.49
76 0.45
77 0.39
78 0.37
79 0.38
80 0.38
81 0.32
82 0.31
83 0.32
84 0.31
85 0.29
86 0.25
87 0.24
88 0.29
89 0.3
90 0.31
91 0.25
92 0.27
93 0.31
94 0.39
95 0.41
96 0.33
97 0.3
98 0.27
99 0.29
100 0.28
101 0.24
102 0.19
103 0.17
104 0.18
105 0.2
106 0.25