Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XPF0

Protein Details
Accession A0A4P6XPF0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-53TTSKNWVLPPRPKNIRKSKPSLEKKKPKPRSCNSQTPVPAHydrophilic
NLS Segment(s)
PositionSequence
23-43PRPKNIRKSKPSLEKKKPKPR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018287  Hap4_TF_heteromerisation  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF10297  Hap4_Hap_bind  
Amino Acid Sequences MPCSPDNQPILTITTSKNWVLPPRPKNIRKSKPSLEKKKPKPRSCNSQTPVPAPNKPSQASQVKCEVSRLSSPMKTGNEVTSCLDSPEQLATNIKLVDRENYQLKTKLLLLIHDYKSLKALVTSPSSDLAPPVDVLYDTATTARKRVYQEMGDPMNDLISDMSGLSHASPHSVVSPVDEELDESGFETELFNFINLEQDSLDHIGEEFEAELHDEDEDDDVDSASLSRLLSPSSDLDENLLMTTLTRSTTVSTTNSLSEKKPFAQHFKFHNLPEFSEEDYVFLFEKELSHEKMMSVIEEDQYNQVADFLEEKLMSNDVQYYVEKTNSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.26
4 0.28
5 0.29
6 0.36
7 0.42
8 0.5
9 0.52
10 0.59
11 0.69
12 0.73
13 0.79
14 0.82
15 0.84
16 0.83
17 0.86
18 0.86
19 0.86
20 0.9
21 0.91
22 0.91
23 0.91
24 0.92
25 0.94
26 0.95
27 0.94
28 0.94
29 0.92
30 0.92
31 0.9
32 0.9
33 0.83
34 0.81
35 0.76
36 0.69
37 0.68
38 0.62
39 0.58
40 0.52
41 0.54
42 0.51
43 0.48
44 0.46
45 0.46
46 0.5
47 0.47
48 0.46
49 0.48
50 0.45
51 0.44
52 0.44
53 0.37
54 0.31
55 0.32
56 0.31
57 0.29
58 0.27
59 0.29
60 0.32
61 0.32
62 0.31
63 0.3
64 0.31
65 0.27
66 0.27
67 0.28
68 0.24
69 0.22
70 0.21
71 0.19
72 0.15
73 0.14
74 0.15
75 0.13
76 0.12
77 0.13
78 0.13
79 0.15
80 0.16
81 0.15
82 0.15
83 0.15
84 0.17
85 0.17
86 0.21
87 0.23
88 0.25
89 0.28
90 0.29
91 0.29
92 0.28
93 0.27
94 0.27
95 0.22
96 0.21
97 0.22
98 0.27
99 0.27
100 0.31
101 0.3
102 0.26
103 0.27
104 0.26
105 0.21
106 0.14
107 0.15
108 0.13
109 0.15
110 0.16
111 0.15
112 0.15
113 0.16
114 0.15
115 0.13
116 0.11
117 0.08
118 0.08
119 0.07
120 0.06
121 0.06
122 0.06
123 0.07
124 0.06
125 0.06
126 0.07
127 0.1
128 0.1
129 0.11
130 0.12
131 0.15
132 0.17
133 0.22
134 0.25
135 0.24
136 0.27
137 0.31
138 0.31
139 0.27
140 0.25
141 0.21
142 0.16
143 0.14
144 0.11
145 0.05
146 0.04
147 0.04
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.05
156 0.05
157 0.05
158 0.06
159 0.07
160 0.07
161 0.07
162 0.09
163 0.08
164 0.08
165 0.08
166 0.08
167 0.07
168 0.07
169 0.06
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.04
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.09
182 0.09
183 0.09
184 0.09
185 0.09
186 0.1
187 0.11
188 0.11
189 0.07
190 0.07
191 0.06
192 0.06
193 0.06
194 0.04
195 0.03
196 0.04
197 0.04
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.06
216 0.07
217 0.07
218 0.09
219 0.1
220 0.12
221 0.13
222 0.12
223 0.13
224 0.13
225 0.13
226 0.11
227 0.1
228 0.06
229 0.06
230 0.07
231 0.06
232 0.07
233 0.07
234 0.07
235 0.09
236 0.11
237 0.13
238 0.14
239 0.16
240 0.17
241 0.19
242 0.22
243 0.23
244 0.23
245 0.26
246 0.27
247 0.29
248 0.35
249 0.38
250 0.45
251 0.49
252 0.54
253 0.56
254 0.61
255 0.62
256 0.57
257 0.6
258 0.52
259 0.47
260 0.44
261 0.4
262 0.33
263 0.31
264 0.28
265 0.2
266 0.19
267 0.18
268 0.14
269 0.12
270 0.11
271 0.08
272 0.09
273 0.14
274 0.18
275 0.2
276 0.22
277 0.23
278 0.22
279 0.25
280 0.25
281 0.2
282 0.18
283 0.16
284 0.16
285 0.16
286 0.17
287 0.16
288 0.16
289 0.16
290 0.13
291 0.12
292 0.11
293 0.11
294 0.11
295 0.11
296 0.12
297 0.12
298 0.13
299 0.14
300 0.15
301 0.14
302 0.13
303 0.15
304 0.13
305 0.16
306 0.16
307 0.19
308 0.21