Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XLP8

Protein Details
Accession A0A4P6XLP8   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-80EAIKKANKVEKAKKNKQLSKNLEKEKHydrophilic
NLS Segment(s)
PositionSequence
51-84KLTKEAIKKANKVEKAKKNKQLSKNLEKEKLFKK
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MAFSSSLSKARSQAAVNKLFETMLPGSTTQFNSLKKSSTTENFSREVSLKKLTKEAIKKANKVEKAKKNKQLSKNLEKEKLFKKNVKYNVIKAHKNSENFSEEEQKYLKRLIKKNSFAVRRAGSLDDPVIKDEVDELRNEILALTNEKYDRSKARQHQAKLNSFNEKIKTGVLTYPGLTPGLAPVDYDDDSDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.45
4 0.43
5 0.4
6 0.36
7 0.32
8 0.29
9 0.22
10 0.16
11 0.15
12 0.15
13 0.16
14 0.19
15 0.21
16 0.2
17 0.24
18 0.25
19 0.29
20 0.3
21 0.32
22 0.29
23 0.32
24 0.33
25 0.34
26 0.39
27 0.39
28 0.41
29 0.4
30 0.39
31 0.39
32 0.35
33 0.32
34 0.28
35 0.31
36 0.3
37 0.3
38 0.33
39 0.33
40 0.39
41 0.43
42 0.47
43 0.5
44 0.53
45 0.56
46 0.61
47 0.66
48 0.66
49 0.67
50 0.7
51 0.69
52 0.73
53 0.78
54 0.79
55 0.81
56 0.83
57 0.83
58 0.83
59 0.82
60 0.82
61 0.82
62 0.79
63 0.76
64 0.68
65 0.66
66 0.63
67 0.63
68 0.58
69 0.54
70 0.55
71 0.56
72 0.62
73 0.64
74 0.59
75 0.55
76 0.6
77 0.61
78 0.57
79 0.5
80 0.51
81 0.46
82 0.45
83 0.41
84 0.35
85 0.31
86 0.28
87 0.29
88 0.29
89 0.25
90 0.25
91 0.25
92 0.22
93 0.2
94 0.24
95 0.26
96 0.26
97 0.32
98 0.4
99 0.48
100 0.52
101 0.59
102 0.63
103 0.64
104 0.58
105 0.57
106 0.49
107 0.41
108 0.38
109 0.31
110 0.23
111 0.2
112 0.2
113 0.17
114 0.16
115 0.15
116 0.14
117 0.12
118 0.11
119 0.12
120 0.14
121 0.12
122 0.11
123 0.12
124 0.12
125 0.12
126 0.12
127 0.1
128 0.09
129 0.09
130 0.12
131 0.11
132 0.13
133 0.14
134 0.15
135 0.17
136 0.2
137 0.25
138 0.29
139 0.38
140 0.44
141 0.54
142 0.61
143 0.65
144 0.7
145 0.72
146 0.76
147 0.73
148 0.7
149 0.67
150 0.61
151 0.61
152 0.55
153 0.47
154 0.39
155 0.33
156 0.3
157 0.24
158 0.24
159 0.22
160 0.21
161 0.2
162 0.2
163 0.2
164 0.18
165 0.16
166 0.14
167 0.12
168 0.14
169 0.12
170 0.11
171 0.12
172 0.16
173 0.16
174 0.17