Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XT99

Protein Details
Accession A0A4P6XT99   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
329-351RDNEWQKAGGKRRRRSPIDDSDLHydrophilic
NLS Segment(s)
PositionSequence
215-216KK
338-343GKRRRR
Subcellular Location(s) mito 9.5, nucl 9, cyto_mito 7, cyto 3.5, plas 1, pero 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MFWQLRTLLGLVRLSICSAQHAFTKFSPMWQIAASQPAQGNMALAAELEASITPQTYSPLLSPAFSPIIWNFSDSPILYRPLYAAITSFMEIDGGPATQVRSFEDIAEDLGEVSSALSERCISETFEANFLAVTFPEAVDDLQGWYTMPNNGISMILASSPKVESELPETSGNSSAVPATTEPLSREGPDAWRRISAPKVTKVAVPDTKWHVKGKKRRFSQVDKPAVEVENGLPEISSVTNLSAAVGFMRDMNTFKALEGLDDEAFQIARPAKKTVSEEDEFLAKILAKRQQRAMAAKIAWMAPKIVPFRDTVETFRSVSPDHSKAQLRDNEWQKAGGKRRRRSPIDDSDLDFDAITNWVLEEVANLAAGPISV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.17
4 0.18
5 0.19
6 0.19
7 0.22
8 0.25
9 0.27
10 0.26
11 0.34
12 0.29
13 0.31
14 0.35
15 0.31
16 0.3
17 0.26
18 0.28
19 0.22
20 0.28
21 0.25
22 0.23
23 0.22
24 0.21
25 0.22
26 0.19
27 0.18
28 0.12
29 0.12
30 0.08
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.08
43 0.09
44 0.1
45 0.1
46 0.14
47 0.15
48 0.15
49 0.15
50 0.17
51 0.18
52 0.16
53 0.18
54 0.14
55 0.17
56 0.17
57 0.19
58 0.16
59 0.16
60 0.19
61 0.17
62 0.19
63 0.19
64 0.22
65 0.19
66 0.18
67 0.18
68 0.17
69 0.18
70 0.14
71 0.12
72 0.11
73 0.12
74 0.12
75 0.12
76 0.09
77 0.09
78 0.08
79 0.09
80 0.07
81 0.06
82 0.05
83 0.06
84 0.07
85 0.08
86 0.09
87 0.1
88 0.12
89 0.13
90 0.13
91 0.14
92 0.13
93 0.12
94 0.12
95 0.1
96 0.07
97 0.07
98 0.06
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.07
108 0.08
109 0.09
110 0.11
111 0.16
112 0.17
113 0.18
114 0.17
115 0.15
116 0.14
117 0.13
118 0.11
119 0.06
120 0.07
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.05
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.08
140 0.07
141 0.07
142 0.06
143 0.06
144 0.05
145 0.05
146 0.06
147 0.06
148 0.06
149 0.07
150 0.07
151 0.07
152 0.12
153 0.13
154 0.15
155 0.15
156 0.16
157 0.15
158 0.17
159 0.16
160 0.11
161 0.1
162 0.08
163 0.07
164 0.07
165 0.06
166 0.06
167 0.07
168 0.07
169 0.08
170 0.11
171 0.11
172 0.11
173 0.12
174 0.12
175 0.17
176 0.21
177 0.23
178 0.2
179 0.21
180 0.21
181 0.23
182 0.26
183 0.27
184 0.27
185 0.3
186 0.31
187 0.31
188 0.31
189 0.31
190 0.33
191 0.31
192 0.27
193 0.26
194 0.3
195 0.34
196 0.35
197 0.39
198 0.39
199 0.44
200 0.53
201 0.6
202 0.63
203 0.63
204 0.7
205 0.72
206 0.74
207 0.76
208 0.77
209 0.75
210 0.66
211 0.63
212 0.56
213 0.48
214 0.4
215 0.3
216 0.2
217 0.13
218 0.12
219 0.1
220 0.08
221 0.07
222 0.08
223 0.07
224 0.07
225 0.05
226 0.05
227 0.06
228 0.06
229 0.06
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.07
238 0.08
239 0.09
240 0.11
241 0.11
242 0.11
243 0.14
244 0.12
245 0.12
246 0.12
247 0.13
248 0.11
249 0.11
250 0.11
251 0.09
252 0.09
253 0.08
254 0.1
255 0.11
256 0.14
257 0.16
258 0.19
259 0.2
260 0.25
261 0.28
262 0.3
263 0.34
264 0.32
265 0.32
266 0.3
267 0.31
268 0.26
269 0.23
270 0.18
271 0.12
272 0.12
273 0.16
274 0.21
275 0.25
276 0.29
277 0.34
278 0.39
279 0.43
280 0.47
281 0.46
282 0.46
283 0.41
284 0.39
285 0.36
286 0.32
287 0.27
288 0.23
289 0.21
290 0.15
291 0.2
292 0.22
293 0.21
294 0.21
295 0.21
296 0.25
297 0.29
298 0.3
299 0.28
300 0.29
301 0.31
302 0.32
303 0.31
304 0.29
305 0.24
306 0.28
307 0.31
308 0.31
309 0.3
310 0.35
311 0.41
312 0.41
313 0.49
314 0.5
315 0.47
316 0.53
317 0.58
318 0.58
319 0.53
320 0.54
321 0.5
322 0.52
323 0.58
324 0.58
325 0.61
326 0.63
327 0.71
328 0.78
329 0.81
330 0.8
331 0.8
332 0.81
333 0.8
334 0.75
335 0.69
336 0.62
337 0.56
338 0.48
339 0.38
340 0.27
341 0.19
342 0.16
343 0.12
344 0.09
345 0.07
346 0.07
347 0.07
348 0.07
349 0.06
350 0.07
351 0.07
352 0.07
353 0.06
354 0.06