Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XEL5

Protein Details
Accession A0A4P6XEL5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
35-57LMFGAKKEKKEDKKEKEEKAEKDBasic
NLS Segment(s)
PositionSequence
40-57KKEKKEDKKEKEEKAEKD
Subcellular Location(s) cyto 17.5, cyto_nucl 13, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
IPR000156  Ran_bind_dom  
IPR045255  RanBP1-like  
IPR045256  RanBP1_RanBD  
Gene Ontology GO:0006913  P:nucleocytoplasmic transport  
Pfam View protein in Pfam  
PF00638  Ran_BP1  
PROSITE View protein in PROSITE  
PS50196  RANBD1  
CDD cd13179  RanBD_RanBP1  
Amino Acid Sequences MSADETKPTVEAPAAAAAAATTTEAPKPPTANVFLMFGAKKEKKEDKKEKEEKAEKDSKDAADKKEGAEDDAEAEVDVHFEPLVHLEKVEVKTNEEDEEVMFKVRAKLFRFHADTQEWKERGTGDVKFLKHKETKKTRVLMRRDKTLKICANHLVQGDYELKPNIGSDRSWVYTVTADISEGEPEAQTLAIRFGNKENADKFKEHFDEAKKGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.09
5 0.08
6 0.08
7 0.07
8 0.05
9 0.06
10 0.08
11 0.1
12 0.13
13 0.16
14 0.18
15 0.19
16 0.23
17 0.26
18 0.27
19 0.26
20 0.25
21 0.23
22 0.25
23 0.23
24 0.2
25 0.25
26 0.26
27 0.27
28 0.33
29 0.42
30 0.48
31 0.59
32 0.7
33 0.71
34 0.79
35 0.86
36 0.86
37 0.87
38 0.86
39 0.79
40 0.77
41 0.75
42 0.65
43 0.61
44 0.56
45 0.47
46 0.48
47 0.48
48 0.42
49 0.4
50 0.41
51 0.36
52 0.37
53 0.35
54 0.27
55 0.23
56 0.19
57 0.14
58 0.13
59 0.12
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.04
69 0.06
70 0.09
71 0.08
72 0.08
73 0.08
74 0.13
75 0.15
76 0.21
77 0.19
78 0.18
79 0.2
80 0.21
81 0.21
82 0.16
83 0.15
84 0.1
85 0.11
86 0.09
87 0.09
88 0.08
89 0.07
90 0.11
91 0.13
92 0.17
93 0.18
94 0.22
95 0.25
96 0.31
97 0.36
98 0.34
99 0.36
100 0.34
101 0.35
102 0.36
103 0.41
104 0.35
105 0.3
106 0.29
107 0.25
108 0.25
109 0.24
110 0.2
111 0.17
112 0.22
113 0.23
114 0.28
115 0.28
116 0.33
117 0.36
118 0.41
119 0.46
120 0.51
121 0.59
122 0.61
123 0.67
124 0.69
125 0.71
126 0.75
127 0.75
128 0.7
129 0.72
130 0.68
131 0.66
132 0.63
133 0.63
134 0.59
135 0.5
136 0.49
137 0.44
138 0.42
139 0.4
140 0.37
141 0.29
142 0.22
143 0.23
144 0.23
145 0.18
146 0.18
147 0.15
148 0.15
149 0.14
150 0.15
151 0.14
152 0.13
153 0.12
154 0.13
155 0.18
156 0.2
157 0.2
158 0.2
159 0.19
160 0.18
161 0.19
162 0.17
163 0.12
164 0.11
165 0.11
166 0.11
167 0.1
168 0.1
169 0.1
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.09
177 0.11
178 0.12
179 0.14
180 0.17
181 0.25
182 0.27
183 0.33
184 0.36
185 0.41
186 0.44
187 0.45
188 0.44
189 0.45
190 0.46
191 0.44
192 0.46
193 0.44