Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XMI2

Protein Details
Accession A0A4P6XMI2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MEMDKIRKKSNKKLSHSLKHKSERSTHydrophilic
NLS Segment(s)
PositionSequence
7-20RKKSNKKLSHSLKH
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MEMDKIRKKSNKKLSHSLKHKSERSTKVEGVLATKIQQSIEKARYVQTARKSNWDLINKNIVIRNDLLENKAKNDQKISEKEAEKRAEEEYVKLFFESDQKDENVAEEPTEPAKETNSAGNIYAMLEETDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.87
5 0.86
6 0.85
7 0.83
8 0.8
9 0.79
10 0.76
11 0.73
12 0.71
13 0.62
14 0.56
15 0.53
16 0.45
17 0.38
18 0.31
19 0.26
20 0.19
21 0.19
22 0.17
23 0.14
24 0.16
25 0.16
26 0.21
27 0.24
28 0.24
29 0.24
30 0.25
31 0.3
32 0.31
33 0.33
34 0.34
35 0.4
36 0.39
37 0.45
38 0.46
39 0.45
40 0.5
41 0.51
42 0.44
43 0.39
44 0.44
45 0.37
46 0.36
47 0.34
48 0.27
49 0.22
50 0.21
51 0.18
52 0.14
53 0.15
54 0.15
55 0.16
56 0.16
57 0.17
58 0.23
59 0.24
60 0.23
61 0.25
62 0.28
63 0.3
64 0.34
65 0.37
66 0.38
67 0.39
68 0.43
69 0.47
70 0.46
71 0.4
72 0.37
73 0.33
74 0.3
75 0.28
76 0.25
77 0.21
78 0.2
79 0.19
80 0.18
81 0.17
82 0.13
83 0.19
84 0.19
85 0.19
86 0.2
87 0.2
88 0.22
89 0.21
90 0.22
91 0.18
92 0.15
93 0.14
94 0.11
95 0.13
96 0.13
97 0.14
98 0.14
99 0.12
100 0.14
101 0.15
102 0.16
103 0.19
104 0.19
105 0.2
106 0.2
107 0.2
108 0.18
109 0.16
110 0.15
111 0.11