Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XRX1

Protein Details
Accession A0A4P6XRX1    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-105AEKSEKKGKKPLKSAQKAAEHydrophilic
250-272EEEPKKAKKAKEDKKKVQFTKELBasic
275-295GPTPLKKDKKAEKAEKAKAEKBasic
NLS Segment(s)
PositionSequence
90-98EKKGKKPLK
243-309RGKKRAAEEEPKKAKKAKEDKKKVQFTKELEQGPTPLKKDKKAEKAEKAKAEKSEKSEKTEKAEKKF
Subcellular Location(s) cyto 19.5, cyto_nucl 12.833, nucl 5, mito_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR041232  NPL  
IPR046357  PPIase_dom_sf  
IPR001179  PPIase_FKBP_dom  
IPR023566  PPIase_Fpr3/Fpr4-like  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
Pfam View protein in Pfam  
PF00254  FKBP_C  
PF17800  NPL  
PROSITE View protein in PROSITE  
PS50059  FKBP_PPIASE  
Amino Acid Sequences MPAMIPLSTYNLALQPFTPAPAVQPEYPVAVRITLAAVDLEAVDEKAEPSTVRILKSRREFIDDYSDLDAEESDELDSDNEAEAAAEKSEKKGKKPLKSAQKAAEEAEEDEEELSGDDSDVEDDADIEEFVLCTLSPKVQFQQTLDFTITPEEEVHFVVTGLYPVHLIGNYILHPANDSDSEEDEDYDSDELDDDYYQDAGAEDADGDNLTPDEDELMRIEDLEDESDVERKIEELVEQDALRGKKRAAEEEPKKAKKAKEDKKKVQFTKELEQGPTPLKKDKKAEKAEKAKAEKSEKSEKTEKAEKKFKVSTLLGGVVTEDRKTGSGALAKLGNKVGIRYIGKLKNGKVFDKNTSGKPFVFNLGKGECIKGFDLGVAGMAVGGERRVVIPAKMGYGSQALPGIPANSELTFDIKLVSLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.19
5 0.19
6 0.16
7 0.18
8 0.24
9 0.29
10 0.23
11 0.26
12 0.25
13 0.28
14 0.28
15 0.28
16 0.21
17 0.17
18 0.16
19 0.14
20 0.14
21 0.1
22 0.1
23 0.08
24 0.07
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.08
36 0.09
37 0.18
38 0.21
39 0.23
40 0.29
41 0.33
42 0.41
43 0.5
44 0.55
45 0.49
46 0.54
47 0.53
48 0.5
49 0.56
50 0.48
51 0.42
52 0.37
53 0.34
54 0.26
55 0.25
56 0.21
57 0.12
58 0.11
59 0.08
60 0.06
61 0.06
62 0.06
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.09
74 0.09
75 0.13
76 0.22
77 0.25
78 0.29
79 0.38
80 0.47
81 0.54
82 0.63
83 0.69
84 0.72
85 0.78
86 0.8
87 0.78
88 0.77
89 0.68
90 0.6
91 0.53
92 0.43
93 0.35
94 0.3
95 0.22
96 0.15
97 0.13
98 0.12
99 0.09
100 0.08
101 0.07
102 0.05
103 0.05
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.08
123 0.1
124 0.12
125 0.15
126 0.18
127 0.2
128 0.21
129 0.27
130 0.26
131 0.28
132 0.27
133 0.24
134 0.21
135 0.2
136 0.19
137 0.12
138 0.11
139 0.09
140 0.08
141 0.09
142 0.09
143 0.07
144 0.07
145 0.07
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.08
159 0.08
160 0.08
161 0.09
162 0.08
163 0.09
164 0.09
165 0.09
166 0.09
167 0.1
168 0.11
169 0.11
170 0.11
171 0.1
172 0.09
173 0.09
174 0.08
175 0.06
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.04
182 0.05
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.04
201 0.04
202 0.04
203 0.05
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.05
213 0.06
214 0.07
215 0.07
216 0.07
217 0.06
218 0.06
219 0.07
220 0.06
221 0.07
222 0.06
223 0.08
224 0.09
225 0.09
226 0.1
227 0.13
228 0.14
229 0.15
230 0.15
231 0.14
232 0.17
233 0.19
234 0.24
235 0.26
236 0.36
237 0.41
238 0.5
239 0.6
240 0.59
241 0.6
242 0.6
243 0.57
244 0.56
245 0.61
246 0.61
247 0.62
248 0.7
249 0.78
250 0.82
251 0.9
252 0.84
253 0.81
254 0.78
255 0.72
256 0.7
257 0.66
258 0.59
259 0.5
260 0.46
261 0.41
262 0.38
263 0.36
264 0.3
265 0.31
266 0.32
267 0.36
268 0.44
269 0.51
270 0.57
271 0.63
272 0.71
273 0.73
274 0.8
275 0.82
276 0.81
277 0.78
278 0.72
279 0.69
280 0.66
281 0.61
282 0.57
283 0.6
284 0.55
285 0.56
286 0.59
287 0.55
288 0.55
289 0.6
290 0.61
291 0.59
292 0.66
293 0.61
294 0.61
295 0.62
296 0.57
297 0.55
298 0.49
299 0.43
300 0.37
301 0.37
302 0.29
303 0.24
304 0.23
305 0.18
306 0.17
307 0.14
308 0.11
309 0.09
310 0.1
311 0.1
312 0.11
313 0.11
314 0.15
315 0.16
316 0.18
317 0.22
318 0.22
319 0.24
320 0.24
321 0.23
322 0.19
323 0.19
324 0.19
325 0.21
326 0.22
327 0.23
328 0.32
329 0.34
330 0.4
331 0.45
332 0.47
333 0.48
334 0.51
335 0.52
336 0.51
337 0.51
338 0.5
339 0.54
340 0.55
341 0.54
342 0.57
343 0.55
344 0.48
345 0.46
346 0.43
347 0.4
348 0.39
349 0.33
350 0.32
351 0.3
352 0.33
353 0.3
354 0.31
355 0.25
356 0.24
357 0.24
358 0.19
359 0.18
360 0.14
361 0.14
362 0.11
363 0.11
364 0.07
365 0.06
366 0.05
367 0.05
368 0.04
369 0.04
370 0.04
371 0.04
372 0.04
373 0.05
374 0.08
375 0.1
376 0.11
377 0.16
378 0.18
379 0.2
380 0.21
381 0.2
382 0.19
383 0.21
384 0.21
385 0.17
386 0.17
387 0.14
388 0.15
389 0.16
390 0.15
391 0.12
392 0.14
393 0.15
394 0.13
395 0.15
396 0.15
397 0.16
398 0.16
399 0.16
400 0.15