Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XXW4

Protein Details
Accession A0A4P6XXW4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-120HKSIKRFWKLMKRYKSRSDDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006281  P:DNA repair  
Amino Acid Sequences MNEKFSAGFKQCLDLSDDIILDLVGEFIELDRHTVEKKLIPRMLDEVNPVFVLARQSELIGRAITGDIAPYITFLLVQKFSDNDIWLLVAPLLSKQCRDHKSIKRFWKLMKRYKSRSDDVSLDLKTFLRALIEEDLFVRRAPRKYMPKLEYILNKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.2
5 0.16
6 0.15
7 0.13
8 0.08
9 0.07
10 0.05
11 0.03
12 0.03
13 0.03
14 0.03
15 0.06
16 0.06
17 0.07
18 0.07
19 0.09
20 0.1
21 0.12
22 0.14
23 0.17
24 0.22
25 0.3
26 0.32
27 0.31
28 0.32
29 0.35
30 0.35
31 0.31
32 0.29
33 0.22
34 0.2
35 0.19
36 0.17
37 0.13
38 0.12
39 0.12
40 0.09
41 0.09
42 0.08
43 0.09
44 0.09
45 0.11
46 0.11
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.04
61 0.04
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.09
68 0.1
69 0.1
70 0.08
71 0.08
72 0.08
73 0.07
74 0.07
75 0.06
76 0.05
77 0.04
78 0.05
79 0.08
80 0.08
81 0.1
82 0.13
83 0.22
84 0.25
85 0.31
86 0.39
87 0.47
88 0.56
89 0.64
90 0.7
91 0.7
92 0.72
93 0.74
94 0.75
95 0.75
96 0.75
97 0.77
98 0.76
99 0.75
100 0.81
101 0.8
102 0.74
103 0.7
104 0.65
105 0.57
106 0.51
107 0.49
108 0.4
109 0.33
110 0.3
111 0.25
112 0.2
113 0.18
114 0.14
115 0.09
116 0.09
117 0.11
118 0.15
119 0.15
120 0.14
121 0.15
122 0.17
123 0.17
124 0.17
125 0.19
126 0.21
127 0.24
128 0.3
129 0.39
130 0.47
131 0.56
132 0.66
133 0.65
134 0.66
135 0.65
136 0.67