FuNGI

A0A4P6XW34

Protein Details

Accession

A0A4P6XW34

Localization Confidence

Medium

Confidence Score

11.7

NoLS Segment(s)

Position	Sequence	Protein Nature
78-97	MSLLGDRKKYQRRARCILTF	Hydrophilic
449-477	TNGYAVQAPKDKKKPKKVKNKGTFYPGNQ	Hydrophilic

NLS Segment(s)

Position	Sequence
458-469	KDKKKPKKVKNK

Subcellular Location(s)

mito 12, mito_nucl 10, cyto 8, nucl 6

Family & Domain DBs

InterPro	View protein in InterPro IPR002305 aa-tRNA-synth_Ic IPR014729 Rossmann-like_a/b/a_fold IPR002307 Tyr-tRNA-ligase
Gene Ontology	GO:0005524 F:ATP binding GO:0004831 F:tyrosine-tRNA ligase activity GO:0006437 P:tyrosyl-tRNA aminoacylation
Pfam	View protein in Pfam PF00579 tRNA-synt_1b
CDD	cd00805 TyrRS_core

Amino Acid Sequences

MKWPWLSSNIWRWLGTHFINMHSTHLFSDASHTSHTNIVFYLINPGSEKAHFLLPSFSDSQPRQLIDTNPRQEVRVCMSLLGDRKKYQRRARCILTFYNSRTMNAEEKFELITKGLQEVLNPQILKEVLEKNERPVKIYWGTAPTGKPHCGYFVPMIKLAHFLKAGCEVKVLIADLHAYLDNMKAPLEVVRHRAKYYEYVVKTILKSINVPIDKLKFVVGSDYQLKAEYTMDLFRLSNSVSQNDAKRAGADVVKQVANPLLSGLIYPLMQALDEQHLDVDVQFGGVDQRKIFVLAEENLPSMGYKKRAHLMNPMVPGLGQGGKMSASDPNSKIDVTEEPKVVRKKIMSAFCAPGNVEQNGLLSFLENIVQPIQELKSGQDGVFDFFVDRPEKYGGPIRYSSFEQLKADFAEEKLSPVDLKEGVAEKINELLAPIREAYASDAEFQACSTNGYAVQAPKDKKKPKKVKNKGTFYPGNQASAEEVSEKLQSTVL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.46
2	0.39
3	0.37
4	0.3
5	0.3
6	0.34
7	0.33
8	0.34
9	0.28
10	0.28
11	0.21
12	0.22
13	0.19
14	0.15
15	0.2
16	0.19
17	0.2
18	0.21
19	0.21
20	0.21
21	0.25
22	0.25
23	0.2
24	0.17
25	0.18
26	0.16
27	0.16
28	0.22
29	0.18
30	0.19
31	0.19
32	0.21
33	0.21
34	0.21
35	0.23
36	0.16
37	0.21
38	0.2
39	0.2
40	0.23
41	0.21
42	0.26
43	0.27
44	0.26
45	0.29
46	0.3
47	0.35
48	0.36
49	0.35
50	0.33
51	0.33
52	0.39
53	0.41
54	0.51
55	0.49
56	0.51
57	0.51
58	0.49
59	0.47
60	0.45
61	0.41
62	0.36
63	0.31
64	0.26
65	0.26
66	0.29
67	0.35
68	0.37
69	0.35
70	0.34
71	0.43
72	0.52
73	0.61
74	0.67
75	0.69
76	0.72
77	0.77
78	0.81
79	0.79
80	0.75
81	0.72
82	0.69
83	0.65
84	0.59
85	0.59
86	0.51
87	0.44
88	0.41
89	0.38
90	0.37
91	0.32
92	0.32
93	0.24
94	0.24
95	0.24
96	0.23
97	0.2
98	0.14
99	0.15
100	0.12
101	0.13
102	0.14
103	0.13
104	0.12
105	0.15
106	0.17
107	0.2
108	0.19
109	0.18
110	0.19
111	0.19
112	0.19
113	0.2
114	0.22
115	0.22
116	0.3
117	0.3
118	0.34
119	0.42
120	0.4
121	0.39
122	0.36
123	0.38
124	0.33
125	0.34
126	0.31
127	0.27
128	0.28
129	0.29
130	0.28
131	0.28
132	0.3
133	0.3
134	0.27
135	0.24
136	0.26
137	0.23
138	0.25
139	0.25
140	0.27
141	0.27
142	0.29
143	0.28
144	0.26
145	0.3
146	0.27
147	0.24
148	0.19
149	0.16
150	0.15
151	0.23
152	0.24
153	0.19
154	0.19
155	0.17
156	0.16
157	0.17
158	0.16
159	0.07
160	0.06
161	0.07
162	0.06
163	0.07
164	0.06
165	0.06
166	0.06
167	0.06
168	0.07
169	0.07
170	0.07
171	0.06
172	0.06
173	0.08
174	0.11
175	0.13
176	0.18
177	0.24
178	0.26
179	0.26
180	0.27
181	0.27
182	0.28
183	0.31
184	0.34
185	0.29
186	0.29
187	0.3
188	0.32
189	0.3
190	0.3
191	0.26
192	0.18
193	0.18
194	0.18
195	0.24
196	0.21
197	0.22
198	0.21
199	0.21
200	0.21
201	0.2
202	0.19
203	0.12
204	0.12
205	0.14
206	0.11
207	0.12
208	0.14
209	0.14
210	0.14
211	0.14
212	0.14
213	0.12
214	0.12
215	0.09
216	0.08
217	0.08
218	0.08
219	0.08
220	0.09
221	0.08
222	0.08
223	0.08
224	0.11
225	0.11
226	0.11
227	0.13
228	0.15
229	0.17
230	0.18
231	0.19
232	0.16
233	0.15
234	0.15
235	0.14
236	0.13
237	0.12
238	0.12
239	0.13
240	0.13
241	0.13
242	0.13
243	0.12
244	0.11
245	0.1
246	0.08
247	0.05
248	0.05
249	0.05
250	0.05
251	0.04
252	0.04
253	0.04
254	0.04
255	0.04
256	0.04
257	0.04
258	0.05
259	0.06
260	0.07
261	0.07
262	0.06
263	0.06
264	0.07
265	0.07
266	0.06
267	0.04
268	0.04
269	0.04
270	0.04
271	0.06
272	0.08
273	0.09
274	0.08
275	0.09
276	0.09
277	0.1
278	0.1
279	0.08
280	0.1
281	0.1
282	0.13
283	0.13
284	0.13
285	0.12
286	0.12
287	0.11
288	0.1
289	0.12
290	0.16
291	0.17
292	0.19
293	0.25
294	0.28
295	0.3
296	0.37
297	0.41
298	0.41
299	0.41
300	0.39
301	0.33
302	0.3
303	0.28
304	0.21
305	0.15
306	0.09
307	0.07
308	0.07
309	0.07
310	0.07
311	0.08
312	0.09
313	0.11
314	0.16
315	0.17
316	0.19
317	0.2
318	0.2
319	0.2
320	0.19
321	0.21
322	0.2
323	0.23
324	0.23
325	0.23
326	0.3
327	0.34
328	0.33
329	0.32
330	0.29
331	0.32
332	0.38
333	0.43
334	0.4
335	0.41
336	0.42
337	0.39
338	0.39
339	0.32
340	0.29
341	0.26
342	0.22
343	0.18
344	0.15
345	0.15
346	0.14
347	0.14
348	0.1
349	0.07
350	0.07
351	0.06
352	0.07
353	0.06
354	0.07
355	0.07
356	0.07
357	0.07
358	0.09
359	0.09
360	0.1
361	0.11
362	0.11
363	0.15
364	0.17
365	0.16
366	0.18
367	0.18
368	0.19
369	0.19
370	0.18
371	0.14
372	0.13
373	0.17
374	0.15
375	0.14
376	0.15
377	0.18
378	0.18
379	0.2
380	0.28
381	0.27
382	0.3
383	0.34
384	0.33
385	0.34
386	0.36
387	0.39
388	0.35
389	0.35
390	0.32
391	0.3
392	0.3
393	0.27
394	0.27
395	0.22
396	0.18
397	0.19
398	0.17
399	0.18
400	0.16
401	0.16
402	0.14
403	0.13
404	0.16
405	0.12
406	0.13
407	0.14
408	0.16
409	0.16
410	0.2
411	0.19
412	0.17
413	0.19
414	0.18
415	0.15
416	0.14
417	0.16
418	0.13
419	0.14
420	0.14
421	0.12
422	0.12
423	0.13
424	0.15
425	0.16
426	0.15
427	0.15
428	0.16
429	0.16
430	0.16
431	0.16
432	0.14
433	0.11
434	0.12
435	0.11
436	0.11
437	0.11
438	0.14
439	0.17
440	0.18
441	0.24
442	0.3
443	0.35
444	0.43
445	0.53
446	0.61
447	0.68
448	0.77
449	0.82
450	0.85
451	0.91
452	0.93
453	0.94
454	0.94
455	0.94
456	0.9
457	0.89
458	0.87
459	0.8
460	0.79
461	0.7
462	0.62
463	0.52
464	0.45
465	0.39
466	0.31
467	0.28
468	0.18
469	0.17
470	0.15
471	0.17
472	0.17

A0A4P6XW34

3D AlphaFold-predicted Structure Viewer