Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M217

Protein Details
Accession E2M217    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
81-100GNKARCCKRRPSMYGYFRAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 7, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008862  Tcp11  
KEGG mpr:MPER_13961  -  
Pfam View protein in Pfam  
PF05794  Tcp11  
Amino Acid Sequences MYVNPDSFKAQMEEHSIQANYIRSIFDPALIEQELRHDVFDLASLLRVIGATLKGHCAPMRDQAVEAMVQSAEACKPGGPGNKARCCKRRPSMYGYFRAHEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.26
4 0.24
5 0.25
6 0.24
7 0.17
8 0.16
9 0.16
10 0.13
11 0.17
12 0.16
13 0.15
14 0.15
15 0.14
16 0.16
17 0.16
18 0.15
19 0.11
20 0.14
21 0.14
22 0.13
23 0.13
24 0.1
25 0.1
26 0.1
27 0.11
28 0.09
29 0.07
30 0.07
31 0.06
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.07
41 0.07
42 0.09
43 0.09
44 0.11
45 0.11
46 0.18
47 0.21
48 0.19
49 0.19
50 0.19
51 0.19
52 0.17
53 0.16
54 0.09
55 0.06
56 0.06
57 0.05
58 0.06
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.12
65 0.19
66 0.22
67 0.31
68 0.4
69 0.49
70 0.57
71 0.64
72 0.68
73 0.67
74 0.73
75 0.75
76 0.76
77 0.73
78 0.75
79 0.77
80 0.77
81 0.81
82 0.76