Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TNB1

Protein Details
Accession A7TNB1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
90-112FDAYRECKKQWLRARRQDRSQWEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
KEGG vpo:Kpol_505p20  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSKESKDKLDSPSALDSTLETDKSKVDFANKDDKKDLKFYPDNPESTLAKYRFITKETSQYYDPCQESAQMSFNCLDRNNYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.26
4 0.21
5 0.22
6 0.2
7 0.15
8 0.15
9 0.16
10 0.17
11 0.18
12 0.15
13 0.19
14 0.22
15 0.26
16 0.36
17 0.36
18 0.39
19 0.42
20 0.45
21 0.41
22 0.43
23 0.4
24 0.38
25 0.4
26 0.4
27 0.44
28 0.45
29 0.43
30 0.39
31 0.41
32 0.34
33 0.32
34 0.36
35 0.27
36 0.25
37 0.24
38 0.28
39 0.25
40 0.26
41 0.28
42 0.22
43 0.3
44 0.3
45 0.32
46 0.28
47 0.28
48 0.29
49 0.31
50 0.3
51 0.22
52 0.2
53 0.18
54 0.18
55 0.18
56 0.21
57 0.15
58 0.16
59 0.16
60 0.17
61 0.18
62 0.17
63 0.18
64 0.15
65 0.2
66 0.24
67 0.29
68 0.33
69 0.39
70 0.43
71 0.51
72 0.51
73 0.52
74 0.5
75 0.51
76 0.55
77 0.54
78 0.6
79 0.56
80 0.6
81 0.58
82 0.55
83 0.58
84 0.54
85 0.58
86 0.57
87 0.62
88 0.67
89 0.75
90 0.84
91 0.85
92 0.89