Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1AEY0

Protein Details
Accession A0A4V1AEY0    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
276-304AESSPVPKQVRKRRPPPSIFLNQRKKVRVHydrophilic
NLS Segment(s)
PositionSequence
284-334QVRKRRPPPSIFLNQRKKVRVPERPPAGQATKRAPNKDPSEPKMELRKPVR
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010684  RNA_pol_II_trans_fac_SIII_A  
Gene Ontology GO:0070449  C:elongin complex  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF06881  Elongin_A  
Amino Acid Sequences MVSGVPSLFGLAQSVCIKLSSRITDVGDTPYHLVQPILKRLNAKQLALIEENSPIIMPHTDELWGFLIEKDFPDRPFNPAKLRLLPSGDNAQMPRRNLYKQYASEKEQFLATSADRLRRMTEKLRKEKSKNSITTVQGILVDPTIRRRNTQYNANGRGYNTQKARPTSILGKARRDVLQRLLMFGGVPKVYDPYKPFQSLKANATKQVKSPTRNPIKKEICTSAAKKEDMAVTECVSQKLSSPPIPNRAENPPNIGDTEPESPIAKSMDRDISELAESSPVPKQVRKRRPPPSIFLNQRKKVRVPERPPAGQATKRAPNKDPSEPKMELRKPVRAIKSSIFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.14
4 0.16
5 0.18
6 0.25
7 0.24
8 0.26
9 0.29
10 0.3
11 0.32
12 0.32
13 0.33
14 0.28
15 0.25
16 0.25
17 0.22
18 0.21
19 0.18
20 0.17
21 0.18
22 0.24
23 0.32
24 0.34
25 0.35
26 0.39
27 0.42
28 0.52
29 0.51
30 0.44
31 0.39
32 0.38
33 0.4
34 0.38
35 0.36
36 0.26
37 0.23
38 0.22
39 0.18
40 0.15
41 0.1
42 0.09
43 0.09
44 0.09
45 0.08
46 0.09
47 0.1
48 0.1
49 0.12
50 0.12
51 0.12
52 0.11
53 0.11
54 0.12
55 0.12
56 0.13
57 0.16
58 0.17
59 0.18
60 0.24
61 0.25
62 0.29
63 0.36
64 0.39
65 0.41
66 0.45
67 0.48
68 0.48
69 0.5
70 0.48
71 0.45
72 0.42
73 0.38
74 0.37
75 0.34
76 0.29
77 0.27
78 0.31
79 0.31
80 0.31
81 0.32
82 0.3
83 0.32
84 0.35
85 0.4
86 0.41
87 0.43
88 0.5
89 0.5
90 0.52
91 0.54
92 0.51
93 0.45
94 0.38
95 0.32
96 0.25
97 0.22
98 0.17
99 0.17
100 0.18
101 0.22
102 0.22
103 0.23
104 0.24
105 0.25
106 0.3
107 0.34
108 0.4
109 0.46
110 0.55
111 0.64
112 0.7
113 0.72
114 0.77
115 0.76
116 0.77
117 0.7
118 0.66
119 0.64
120 0.56
121 0.54
122 0.46
123 0.37
124 0.28
125 0.24
126 0.19
127 0.12
128 0.11
129 0.07
130 0.13
131 0.19
132 0.19
133 0.21
134 0.25
135 0.33
136 0.37
137 0.45
138 0.47
139 0.5
140 0.56
141 0.56
142 0.53
143 0.45
144 0.47
145 0.41
146 0.38
147 0.31
148 0.3
149 0.32
150 0.33
151 0.35
152 0.29
153 0.29
154 0.28
155 0.33
156 0.36
157 0.35
158 0.37
159 0.35
160 0.37
161 0.37
162 0.35
163 0.3
164 0.26
165 0.3
166 0.27
167 0.27
168 0.24
169 0.21
170 0.18
171 0.17
172 0.14
173 0.07
174 0.07
175 0.06
176 0.08
177 0.08
178 0.11
179 0.14
180 0.17
181 0.21
182 0.25
183 0.26
184 0.29
185 0.36
186 0.37
187 0.4
188 0.44
189 0.41
190 0.43
191 0.48
192 0.44
193 0.4
194 0.45
195 0.46
196 0.41
197 0.47
198 0.51
199 0.57
200 0.61
201 0.62
202 0.63
203 0.64
204 0.64
205 0.62
206 0.55
207 0.49
208 0.5
209 0.49
210 0.46
211 0.44
212 0.4
213 0.35
214 0.33
215 0.3
216 0.26
217 0.26
218 0.2
219 0.16
220 0.2
221 0.21
222 0.19
223 0.18
224 0.16
225 0.15
226 0.19
227 0.22
228 0.23
229 0.28
230 0.32
231 0.41
232 0.44
233 0.44
234 0.44
235 0.48
236 0.48
237 0.43
238 0.44
239 0.37
240 0.34
241 0.34
242 0.3
243 0.22
244 0.21
245 0.22
246 0.17
247 0.17
248 0.17
249 0.15
250 0.17
251 0.17
252 0.15
253 0.13
254 0.17
255 0.22
256 0.22
257 0.24
258 0.23
259 0.22
260 0.22
261 0.21
262 0.17
263 0.13
264 0.11
265 0.13
266 0.15
267 0.18
268 0.2
269 0.25
270 0.35
271 0.44
272 0.56
273 0.64
274 0.71
275 0.77
276 0.85
277 0.87
278 0.84
279 0.82
280 0.82
281 0.82
282 0.82
283 0.82
284 0.8
285 0.81
286 0.79
287 0.76
288 0.75
289 0.75
290 0.76
291 0.73
292 0.75
293 0.76
294 0.74
295 0.72
296 0.69
297 0.66
298 0.6
299 0.59
300 0.57
301 0.57
302 0.6
303 0.63
304 0.6
305 0.62
306 0.64
307 0.68
308 0.7
309 0.65
310 0.66
311 0.64
312 0.66
313 0.67
314 0.65
315 0.64
316 0.61
317 0.65
318 0.63
319 0.7
320 0.71
321 0.65
322 0.66