Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XK57

Protein Details
Accession A0A4P6XK57    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
175-201DNMLPSKTPGKKNKKKGKKVDVESSQSHydrophilic
NLS Segment(s)
PositionSequence
181-193KTPGKKNKKKGKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MDLIPGVRIISIPRWGASVSRQVLKFFIEYAKDYPTCNQMSVDDLDDGLSYQVDFSNDEVSLSDSDKGSKQLSEIEAEPSVENSKKRSKSGSNLQEKKKVKMQMDIEKKKNLSREPSVDVIADFINDSLRRKNPDLSALEMAELYFKKTDFRSTAEFIEQRNLDNLPKFILSRFDNMLPSKTPGKKNKKKGKKVDVESSQSSDVGDRKFIAIISMSAIRACDVHRSLRDIPGSSLKLINKNKIDVDLKLVGSTWARVLCCTPGRLQKILNNEELALKPEEIKIVIADTSYLDQKMQNIFNISETTPTLKQLTSSGSKIYLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.22
4 0.24
5 0.3
6 0.29
7 0.34
8 0.35
9 0.35
10 0.36
11 0.36
12 0.32
13 0.25
14 0.25
15 0.22
16 0.23
17 0.25
18 0.3
19 0.29
20 0.29
21 0.3
22 0.32
23 0.31
24 0.29
25 0.28
26 0.22
27 0.25
28 0.25
29 0.24
30 0.18
31 0.16
32 0.15
33 0.14
34 0.13
35 0.1
36 0.08
37 0.05
38 0.05
39 0.07
40 0.07
41 0.08
42 0.09
43 0.11
44 0.11
45 0.11
46 0.11
47 0.12
48 0.12
49 0.13
50 0.14
51 0.11
52 0.13
53 0.15
54 0.17
55 0.16
56 0.16
57 0.15
58 0.18
59 0.19
60 0.2
61 0.2
62 0.2
63 0.19
64 0.2
65 0.19
66 0.16
67 0.18
68 0.18
69 0.18
70 0.2
71 0.29
72 0.32
73 0.35
74 0.4
75 0.43
76 0.49
77 0.59
78 0.64
79 0.66
80 0.71
81 0.74
82 0.76
83 0.72
84 0.68
85 0.64
86 0.6
87 0.52
88 0.51
89 0.53
90 0.53
91 0.62
92 0.66
93 0.63
94 0.62
95 0.61
96 0.57
97 0.55
98 0.5
99 0.46
100 0.43
101 0.44
102 0.42
103 0.42
104 0.4
105 0.34
106 0.29
107 0.23
108 0.17
109 0.12
110 0.08
111 0.06
112 0.07
113 0.08
114 0.09
115 0.13
116 0.16
117 0.2
118 0.22
119 0.27
120 0.26
121 0.32
122 0.33
123 0.32
124 0.31
125 0.27
126 0.25
127 0.21
128 0.19
129 0.14
130 0.12
131 0.09
132 0.08
133 0.07
134 0.09
135 0.1
136 0.14
137 0.14
138 0.17
139 0.2
140 0.22
141 0.23
142 0.25
143 0.26
144 0.22
145 0.25
146 0.22
147 0.18
148 0.17
149 0.17
150 0.15
151 0.14
152 0.14
153 0.11
154 0.11
155 0.11
156 0.1
157 0.14
158 0.14
159 0.16
160 0.17
161 0.18
162 0.2
163 0.21
164 0.22
165 0.18
166 0.2
167 0.24
168 0.28
169 0.35
170 0.42
171 0.53
172 0.6
173 0.7
174 0.78
175 0.82
176 0.87
177 0.89
178 0.9
179 0.89
180 0.86
181 0.85
182 0.81
183 0.76
184 0.67
185 0.59
186 0.49
187 0.39
188 0.32
189 0.24
190 0.21
191 0.15
192 0.14
193 0.12
194 0.12
195 0.12
196 0.12
197 0.11
198 0.08
199 0.08
200 0.09
201 0.1
202 0.09
203 0.09
204 0.09
205 0.08
206 0.09
207 0.09
208 0.12
209 0.13
210 0.18
211 0.19
212 0.25
213 0.27
214 0.32
215 0.34
216 0.3
217 0.3
218 0.32
219 0.32
220 0.28
221 0.3
222 0.28
223 0.35
224 0.37
225 0.43
226 0.38
227 0.4
228 0.39
229 0.41
230 0.41
231 0.32
232 0.34
233 0.31
234 0.28
235 0.25
236 0.24
237 0.2
238 0.18
239 0.18
240 0.14
241 0.13
242 0.13
243 0.13
244 0.15
245 0.19
246 0.21
247 0.23
248 0.26
249 0.32
250 0.37
251 0.39
252 0.41
253 0.4
254 0.46
255 0.49
256 0.46
257 0.39
258 0.35
259 0.35
260 0.32
261 0.31
262 0.24
263 0.2
264 0.18
265 0.18
266 0.18
267 0.16
268 0.16
269 0.12
270 0.12
271 0.12
272 0.1
273 0.1
274 0.1
275 0.11
276 0.13
277 0.13
278 0.12
279 0.13
280 0.18
281 0.23
282 0.24
283 0.25
284 0.27
285 0.27
286 0.28
287 0.3
288 0.27
289 0.23
290 0.22
291 0.24
292 0.22
293 0.24
294 0.24
295 0.21
296 0.22
297 0.22
298 0.27
299 0.27
300 0.29
301 0.28