Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P6XP04

Protein Details
Accession A0A4P6XP04   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-27NKSHVLCKRCGRRSFHAQKKTCHydrophilic
NLS Segment(s)
PositionSequence
47-49KRR
Subcellular Location(s) nucl 17, mito_nucl 12.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences MGKRHNKSHVLCKRCGRRSFHAQKKTCSSCGYPAAKMRSHNWALKAKRRRTTGTGRMSHLKHVSRRFNNGFQTSIKADSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.73
4 0.72
5 0.76
6 0.8
7 0.81
8 0.81
9 0.76
10 0.75
11 0.77
12 0.74
13 0.65
14 0.57
15 0.49
16 0.44
17 0.47
18 0.44
19 0.37
20 0.37
21 0.39
22 0.38
23 0.37
24 0.34
25 0.33
26 0.34
27 0.34
28 0.33
29 0.37
30 0.39
31 0.47
32 0.55
33 0.55
34 0.58
35 0.61
36 0.61
37 0.59
38 0.65
39 0.65
40 0.65
41 0.62
42 0.59
43 0.61
44 0.57
45 0.57
46 0.53
47 0.5
48 0.48
49 0.52
50 0.59
51 0.57
52 0.66
53 0.66
54 0.66
55 0.68
56 0.64
57 0.58
58 0.49
59 0.49
60 0.43