Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P6XQT3

Protein Details
Accession A0A4P6XQT3    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSKSKNHTNHNQNKKAHKNGIKKPKTYHydrophilic
NLS Segment(s)
PositionSequence
14-30KKAHKNGIKKPKTYRYR
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHKNGIKKPKTYRYRSLKSVDAKFRRNHRYALQGTAKAIAEGRAGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.8
5 0.79
6 0.8
7 0.84
8 0.81
9 0.77
10 0.77
11 0.78
12 0.78
13 0.75
14 0.75
15 0.74
16 0.73
17 0.72
18 0.67
19 0.63
20 0.61
21 0.61
22 0.61
23 0.57
24 0.58
25 0.58
26 0.64
27 0.66
28 0.62
29 0.59
30 0.53
31 0.56
32 0.53
33 0.56
34 0.53
35 0.46
36 0.44
37 0.43
38 0.39
39 0.3
40 0.28
41 0.2