Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9M234

Protein Details
Accession A0A4Q9M234    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
204-245DEKPLPIPIKPPKRQRGGRKFRKIKNKIKKRIEYSTRQLNKDBasic
NLS Segment(s)
PositionSequence
198-234KVEPKKDEKPLPIPIKPPKRQRGGRKFRKIKNKIKKR
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036070  Nop_dom_sf  
IPR019175  Prp31_C  
Pfam View protein in Pfam  
PF09785  Prp31_C  
Amino Acid Sequences MCNKLLSLRKQEIEKRSKISLNFPMSLLKRIVKSEENAILNQENNYCNSYSILEMLEYKKFKNIYFEMNFDEKRNVLEIFDKLTEIETEKEELFLANKELLEKNYYNLNNILGPKILFNLLYYVDFKSLVYKTSNEFRNILMKCDVQNHLLFLELDKSKKNQLLRIISNKACIAAKLDYFGSKKIDFLSEIKIIFKEKVEPKKDEKPLPIPIKPPKRQRGGRKFRKIKNKIKKRIEYSTRQLNKDEFDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.65
3 0.64
4 0.65
5 0.6
6 0.6
7 0.59
8 0.56
9 0.51
10 0.46
11 0.48
12 0.44
13 0.45
14 0.4
15 0.34
16 0.3
17 0.31
18 0.35
19 0.32
20 0.32
21 0.35
22 0.39
23 0.37
24 0.35
25 0.36
26 0.33
27 0.3
28 0.29
29 0.25
30 0.19
31 0.19
32 0.21
33 0.18
34 0.17
35 0.17
36 0.16
37 0.14
38 0.14
39 0.12
40 0.11
41 0.13
42 0.14
43 0.19
44 0.19
45 0.19
46 0.23
47 0.24
48 0.24
49 0.29
50 0.29
51 0.32
52 0.34
53 0.36
54 0.36
55 0.4
56 0.4
57 0.34
58 0.34
59 0.25
60 0.23
61 0.22
62 0.18
63 0.13
64 0.15
65 0.14
66 0.16
67 0.16
68 0.15
69 0.13
70 0.13
71 0.13
72 0.12
73 0.12
74 0.1
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.1
81 0.09
82 0.09
83 0.08
84 0.08
85 0.1
86 0.11
87 0.12
88 0.15
89 0.14
90 0.14
91 0.2
92 0.2
93 0.2
94 0.19
95 0.19
96 0.18
97 0.18
98 0.18
99 0.11
100 0.11
101 0.1
102 0.1
103 0.09
104 0.07
105 0.06
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.08
112 0.09
113 0.08
114 0.11
115 0.1
116 0.11
117 0.11
118 0.12
119 0.14
120 0.2
121 0.24
122 0.22
123 0.23
124 0.22
125 0.29
126 0.28
127 0.29
128 0.24
129 0.22
130 0.21
131 0.24
132 0.25
133 0.19
134 0.19
135 0.17
136 0.15
137 0.15
138 0.14
139 0.1
140 0.13
141 0.12
142 0.13
143 0.14
144 0.16
145 0.19
146 0.23
147 0.25
148 0.24
149 0.31
150 0.38
151 0.42
152 0.48
153 0.51
154 0.48
155 0.48
156 0.44
157 0.37
158 0.3
159 0.24
160 0.2
161 0.16
162 0.15
163 0.14
164 0.15
165 0.17
166 0.18
167 0.2
168 0.21
169 0.19
170 0.19
171 0.19
172 0.2
173 0.18
174 0.19
175 0.22
176 0.21
177 0.22
178 0.22
179 0.22
180 0.22
181 0.21
182 0.2
183 0.23
184 0.29
185 0.38
186 0.43
187 0.47
188 0.53
189 0.61
190 0.68
191 0.67
192 0.66
193 0.62
194 0.67
195 0.69
196 0.66
197 0.64
198 0.67
199 0.71
200 0.72
201 0.76
202 0.75
203 0.78
204 0.83
205 0.86
206 0.87
207 0.88
208 0.91
209 0.91
210 0.92
211 0.91
212 0.93
213 0.92
214 0.92
215 0.92
216 0.92
217 0.91
218 0.92
219 0.93
220 0.9
221 0.91
222 0.89
223 0.87
224 0.85
225 0.85
226 0.82
227 0.75
228 0.71
229 0.64