Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LH47

Protein Details
Accession A0A4Q9LH47    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-53DNEIRFKRTRQEKKIVDKLYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022495  Bud32  
IPR011009  Kinase-like_dom_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0016310  P:phosphorylation  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MKILAQGAEAKILLIENIIVKERIPKLYRPVELDNEIRFKRTRQEKKIVDKLYQNSILVPKIVKPLQNFDHKTTLFMEYIEGSILKDFLCQIEKYKDNFNKSEHSDSFSIKITEIKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.1
6 0.1
7 0.1
8 0.17
9 0.2
10 0.26
11 0.28
12 0.3
13 0.37
14 0.44
15 0.47
16 0.46
17 0.47
18 0.45
19 0.46
20 0.46
21 0.41
22 0.4
23 0.37
24 0.34
25 0.31
26 0.27
27 0.32
28 0.4
29 0.47
30 0.48
31 0.58
32 0.63
33 0.72
34 0.8
35 0.74
36 0.67
37 0.62
38 0.57
39 0.52
40 0.45
41 0.36
42 0.28
43 0.26
44 0.23
45 0.17
46 0.15
47 0.1
48 0.13
49 0.15
50 0.17
51 0.17
52 0.22
53 0.26
54 0.35
55 0.37
56 0.36
57 0.42
58 0.39
59 0.39
60 0.36
61 0.33
62 0.24
63 0.21
64 0.18
65 0.11
66 0.12
67 0.11
68 0.09
69 0.06
70 0.06
71 0.07
72 0.06
73 0.06
74 0.06
75 0.07
76 0.1
77 0.11
78 0.15
79 0.22
80 0.27
81 0.29
82 0.39
83 0.44
84 0.47
85 0.51
86 0.5
87 0.5
88 0.52
89 0.58
90 0.49
91 0.48
92 0.44
93 0.42
94 0.42
95 0.38
96 0.33
97 0.24