Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LXM9

Protein Details
Accession A0A4Q9LXM9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-28TCNNLKQKSVSKKLIGKKVFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
IPR044539  Pch2-like  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
Amino Acid Sequences MEILVVETTCNNLKQKSVSKKLIGKKVFLESKLTKDIRICELYQKNILKSCGEYEINAETKIILHKYSINNEESFNDYFKKCKIPNMEFEKIWNQIFLENEIKFKILSYYTSMLKLIEKKIDLSHFCLNKAILIYGPPGTGKTSLAKSIANKISIRDKNSFHFLEIDCSSIFSKFYGEGPKILDKIFIEVNELSIKNKVILLIDEIESLMVSRNITMSKNEPLDSIRNVNTFLVCLDKLKANKNVFCIFTTNHIKFLDEAFLDRQDVCIEIGFPNLKNVYEILKNIFEILMKKNLVEYHQILGFQTVINLNEFINEEHKLLYDLTKKMTGKSGRCIRKKTFEAILHNDNNFKSILTYLINLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.41
3 0.49
4 0.56
5 0.6
6 0.65
7 0.73
8 0.79
9 0.81
10 0.75
11 0.68
12 0.64
13 0.65
14 0.63
15 0.56
16 0.55
17 0.49
18 0.51
19 0.56
20 0.52
21 0.45
22 0.43
23 0.46
24 0.44
25 0.45
26 0.4
27 0.4
28 0.45
29 0.47
30 0.51
31 0.51
32 0.48
33 0.49
34 0.49
35 0.41
36 0.37
37 0.36
38 0.34
39 0.3
40 0.26
41 0.24
42 0.28
43 0.28
44 0.26
45 0.23
46 0.17
47 0.17
48 0.21
49 0.19
50 0.14
51 0.14
52 0.2
53 0.25
54 0.31
55 0.34
56 0.34
57 0.33
58 0.34
59 0.34
60 0.32
61 0.29
62 0.24
63 0.24
64 0.21
65 0.22
66 0.24
67 0.31
68 0.28
69 0.34
70 0.42
71 0.43
72 0.52
73 0.59
74 0.61
75 0.53
76 0.56
77 0.53
78 0.46
79 0.41
80 0.32
81 0.23
82 0.2
83 0.21
84 0.21
85 0.22
86 0.19
87 0.2
88 0.19
89 0.19
90 0.17
91 0.16
92 0.15
93 0.1
94 0.11
95 0.15
96 0.17
97 0.18
98 0.19
99 0.19
100 0.18
101 0.2
102 0.23
103 0.21
104 0.22
105 0.21
106 0.22
107 0.25
108 0.29
109 0.28
110 0.28
111 0.32
112 0.3
113 0.3
114 0.3
115 0.27
116 0.23
117 0.22
118 0.17
119 0.1
120 0.09
121 0.1
122 0.09
123 0.1
124 0.08
125 0.08
126 0.09
127 0.1
128 0.1
129 0.12
130 0.12
131 0.14
132 0.15
133 0.16
134 0.17
135 0.24
136 0.26
137 0.26
138 0.25
139 0.25
140 0.34
141 0.36
142 0.38
143 0.34
144 0.34
145 0.33
146 0.39
147 0.37
148 0.28
149 0.28
150 0.24
151 0.24
152 0.22
153 0.21
154 0.15
155 0.15
156 0.15
157 0.12
158 0.11
159 0.07
160 0.08
161 0.07
162 0.09
163 0.12
164 0.13
165 0.13
166 0.16
167 0.18
168 0.18
169 0.17
170 0.16
171 0.12
172 0.14
173 0.13
174 0.11
175 0.11
176 0.1
177 0.11
178 0.12
179 0.12
180 0.11
181 0.11
182 0.12
183 0.09
184 0.1
185 0.09
186 0.07
187 0.08
188 0.09
189 0.09
190 0.09
191 0.09
192 0.08
193 0.08
194 0.07
195 0.07
196 0.06
197 0.05
198 0.04
199 0.04
200 0.06
201 0.07
202 0.08
203 0.1
204 0.12
205 0.16
206 0.18
207 0.18
208 0.18
209 0.19
210 0.22
211 0.22
212 0.23
213 0.21
214 0.19
215 0.2
216 0.2
217 0.17
218 0.15
219 0.12
220 0.11
221 0.1
222 0.1
223 0.1
224 0.14
225 0.17
226 0.23
227 0.31
228 0.33
229 0.35
230 0.39
231 0.42
232 0.39
233 0.37
234 0.34
235 0.27
236 0.3
237 0.36
238 0.32
239 0.32
240 0.3
241 0.3
242 0.28
243 0.28
244 0.24
245 0.16
246 0.17
247 0.15
248 0.16
249 0.16
250 0.15
251 0.14
252 0.11
253 0.12
254 0.1
255 0.08
256 0.09
257 0.08
258 0.11
259 0.12
260 0.12
261 0.15
262 0.16
263 0.15
264 0.15
265 0.16
266 0.16
267 0.17
268 0.18
269 0.19
270 0.19
271 0.19
272 0.19
273 0.18
274 0.16
275 0.16
276 0.18
277 0.21
278 0.2
279 0.2
280 0.22
281 0.24
282 0.24
283 0.27
284 0.26
285 0.23
286 0.24
287 0.25
288 0.22
289 0.21
290 0.19
291 0.13
292 0.13
293 0.11
294 0.11
295 0.12
296 0.12
297 0.11
298 0.12
299 0.13
300 0.13
301 0.14
302 0.15
303 0.14
304 0.14
305 0.14
306 0.14
307 0.14
308 0.19
309 0.23
310 0.24
311 0.27
312 0.34
313 0.34
314 0.35
315 0.43
316 0.45
317 0.43
318 0.51
319 0.58
320 0.61
321 0.69
322 0.75
323 0.74
324 0.76
325 0.76
326 0.72
327 0.72
328 0.69
329 0.69
330 0.69
331 0.7
332 0.65
333 0.63
334 0.6
335 0.51
336 0.45
337 0.36
338 0.29
339 0.21
340 0.16
341 0.17
342 0.14