Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LPT2

Protein Details
Accession A0A4Q9LPT2    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
305-328PEDKNKGDMKKDKEDRQRDGNQNIBasic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 12.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001339  mRNA_cap_enzyme_adenylation  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004484  F:mRNA guanylyltransferase activity  
GO:0006370  P:7-methylguanosine mRNA capping  
Pfam View protein in Pfam  
PF01331  mRNA_cap_enzyme  
CDD cd07895  Adenylation_mRNA_capping  
Amino Acid Sequences MLSLEDVGKKVDEKEKFKIYKKIIEKLNYPFIETLYAKFFGSHPVTLSNETIELLINRDYYVCEKSDGIRVLLYIYNDNKFVYSFFFDRKNDFYLVNINNNIKIGTYLFDGELYNDFGKNSSEIVFSIFDCLIYEGNDFSFQNLQKRLELCQNFINLYKNVDGFKKYKFKIQVKQMFKSYGFYQVYSEIDNLAHKNDGLIFTPVYQPYVFGRCYTLLKWKPPSLNTVDFLLRKNKEVKNCYELLCFGKNNEMIIFDHFFDFEIEEDRGRNVKESNKIKESNINMKNDLYRGEKDGERDGNQNIIPEDKNKGDMKKDKEDRQRDGNQNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.6
4 0.66
5 0.71
6 0.69
7 0.7
8 0.72
9 0.72
10 0.7
11 0.69
12 0.68
13 0.66
14 0.69
15 0.6
16 0.55
17 0.47
18 0.4
19 0.39
20 0.34
21 0.29
22 0.23
23 0.24
24 0.21
25 0.21
26 0.21
27 0.22
28 0.25
29 0.24
30 0.21
31 0.24
32 0.27
33 0.28
34 0.29
35 0.21
36 0.18
37 0.17
38 0.16
39 0.13
40 0.11
41 0.11
42 0.12
43 0.11
44 0.11
45 0.11
46 0.12
47 0.14
48 0.16
49 0.15
50 0.15
51 0.16
52 0.18
53 0.25
54 0.25
55 0.22
56 0.2
57 0.19
58 0.2
59 0.21
60 0.2
61 0.17
62 0.18
63 0.19
64 0.19
65 0.19
66 0.18
67 0.16
68 0.15
69 0.14
70 0.15
71 0.16
72 0.18
73 0.24
74 0.25
75 0.29
76 0.31
77 0.31
78 0.29
79 0.27
80 0.25
81 0.27
82 0.28
83 0.29
84 0.29
85 0.27
86 0.26
87 0.26
88 0.25
89 0.17
90 0.15
91 0.11
92 0.08
93 0.09
94 0.09
95 0.08
96 0.09
97 0.09
98 0.1
99 0.1
100 0.11
101 0.11
102 0.1
103 0.1
104 0.1
105 0.1
106 0.1
107 0.1
108 0.08
109 0.08
110 0.08
111 0.1
112 0.1
113 0.1
114 0.11
115 0.1
116 0.09
117 0.09
118 0.09
119 0.08
120 0.07
121 0.08
122 0.06
123 0.06
124 0.08
125 0.08
126 0.08
127 0.12
128 0.12
129 0.17
130 0.2
131 0.21
132 0.22
133 0.23
134 0.25
135 0.29
136 0.28
137 0.26
138 0.25
139 0.25
140 0.24
141 0.24
142 0.25
143 0.17
144 0.18
145 0.17
146 0.15
147 0.15
148 0.15
149 0.17
150 0.16
151 0.21
152 0.27
153 0.27
154 0.32
155 0.39
156 0.45
157 0.5
158 0.59
159 0.62
160 0.6
161 0.63
162 0.6
163 0.54
164 0.48
165 0.43
166 0.33
167 0.33
168 0.28
169 0.24
170 0.22
171 0.21
172 0.21
173 0.19
174 0.18
175 0.1
176 0.1
177 0.11
178 0.1
179 0.09
180 0.09
181 0.08
182 0.08
183 0.08
184 0.09
185 0.09
186 0.1
187 0.09
188 0.1
189 0.13
190 0.13
191 0.13
192 0.12
193 0.11
194 0.12
195 0.16
196 0.15
197 0.13
198 0.15
199 0.15
200 0.17
201 0.18
202 0.26
203 0.27
204 0.33
205 0.39
206 0.42
207 0.45
208 0.44
209 0.48
210 0.45
211 0.44
212 0.39
213 0.36
214 0.35
215 0.32
216 0.33
217 0.36
218 0.3
219 0.3
220 0.36
221 0.38
222 0.43
223 0.47
224 0.5
225 0.48
226 0.5
227 0.48
228 0.42
229 0.4
230 0.36
231 0.34
232 0.29
233 0.24
234 0.27
235 0.25
236 0.24
237 0.22
238 0.2
239 0.16
240 0.2
241 0.21
242 0.16
243 0.15
244 0.14
245 0.14
246 0.13
247 0.13
248 0.09
249 0.11
250 0.11
251 0.11
252 0.12
253 0.13
254 0.16
255 0.16
256 0.18
257 0.19
258 0.25
259 0.34
260 0.42
261 0.48
262 0.53
263 0.55
264 0.55
265 0.59
266 0.6
267 0.6
268 0.58
269 0.55
270 0.49
271 0.49
272 0.5
273 0.43
274 0.4
275 0.34
276 0.3
277 0.29
278 0.32
279 0.32
280 0.32
281 0.38
282 0.4
283 0.37
284 0.39
285 0.36
286 0.37
287 0.35
288 0.34
289 0.28
290 0.26
291 0.25
292 0.25
293 0.29
294 0.25
295 0.31
296 0.33
297 0.37
298 0.43
299 0.5
300 0.55
301 0.61
302 0.68
303 0.72
304 0.78
305 0.82
306 0.8
307 0.81
308 0.83