Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V2JV56

Protein Details
Accession A0A4V2JV56    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-110LKEKNKLITNEDKKPRKKRNIVTFKRBasic
NLS Segment(s)
PositionSequence
97-106KKPRKKRNIV
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEEKNKELASKNVLLKEEIKKLSDLHTELLKNNIKNNYFCNRTHMKMIAILDENIKAIEHILKDTVDFKTKLEENTNLKNDDRILKEKNKLITNEDKKPRKKRNIVTFKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.43
4 0.44
5 0.4
6 0.36
7 0.33
8 0.33
9 0.35
10 0.35
11 0.31
12 0.25
13 0.28
14 0.28
15 0.27
16 0.34
17 0.34
18 0.3
19 0.33
20 0.37
21 0.35
22 0.35
23 0.39
24 0.39
25 0.38
26 0.37
27 0.39
28 0.37
29 0.37
30 0.38
31 0.34
32 0.28
33 0.27
34 0.27
35 0.23
36 0.19
37 0.17
38 0.15
39 0.13
40 0.12
41 0.09
42 0.08
43 0.06
44 0.05
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.08
51 0.1
52 0.11
53 0.13
54 0.14
55 0.13
56 0.18
57 0.2
58 0.22
59 0.23
60 0.28
61 0.3
62 0.38
63 0.41
64 0.38
65 0.37
66 0.36
67 0.34
68 0.34
69 0.34
70 0.32
71 0.35
72 0.4
73 0.46
74 0.49
75 0.54
76 0.53
77 0.5
78 0.51
79 0.56
80 0.56
81 0.6
82 0.66
83 0.69
84 0.73
85 0.82
86 0.86
87 0.86
88 0.89
89 0.89
90 0.91