Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9M0C4

Protein Details
Accession A0A4Q9M0C4   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
383-415EANKENKKDSTEKKNKYKNFKKGNKRRKNNKLKBasic
NLS Segment(s)
PositionSequence
378-415RKKASEANKENKKDSTEKKNKYKNFKKGNKRRKNNKLK
Subcellular Location(s) nucl 16.5, cyto_nucl 14.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027312  Sda1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0015031  P:protein transport  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0000055  P:ribosomal large subunit export from nucleus  
Amino Acid Sequences MDLVSLQSKIFKDPNNYLEEYTEQLEKYKAFVELPIVPLKTLSTLLSFLTTVSHFYPSQYSSLIINHLSVTTNKLLKKEIFTNILILKRKKLITEEDFFTSIFLHTSDFKSVLRMCVKEISDRKTVEIFIKYVNHGNEKQYFFALFCILYCYEIKKYEELEKIICDNLFDKKGENMCLLYFLNLIDFSFSDNIYEKENQNTEKENENVENTENNSKILIKIGEIKAEEICKLLYKDLRLNKMMRDIRVKKLRVISVLKKFYNLKLKIFDYVVKIVDPSKEDLGQLMTVLIECLTPDEAKKGVDMVLDKFCNLAKDDDMVVYGLNILKEISVRFDLDVISYLEDYKKSKSKAVGYAYKMLVKSYNEKKVVGNRSLLYVRKKASEANKENKKDSTEKKNKYKNFKKGNKRRKNNKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.52
4 0.48
5 0.45
6 0.41
7 0.36
8 0.31
9 0.28
10 0.21
11 0.21
12 0.23
13 0.2
14 0.2
15 0.2
16 0.19
17 0.17
18 0.18
19 0.21
20 0.21
21 0.25
22 0.28
23 0.26
24 0.24
25 0.24
26 0.23
27 0.2
28 0.18
29 0.16
30 0.12
31 0.13
32 0.13
33 0.14
34 0.14
35 0.12
36 0.13
37 0.12
38 0.13
39 0.13
40 0.16
41 0.15
42 0.17
43 0.21
44 0.2
45 0.21
46 0.2
47 0.19
48 0.17
49 0.19
50 0.2
51 0.16
52 0.16
53 0.14
54 0.14
55 0.15
56 0.14
57 0.16
58 0.19
59 0.23
60 0.24
61 0.26
62 0.3
63 0.31
64 0.36
65 0.38
66 0.38
67 0.38
68 0.36
69 0.39
70 0.38
71 0.42
72 0.44
73 0.4
74 0.38
75 0.4
76 0.41
77 0.38
78 0.39
79 0.41
80 0.4
81 0.44
82 0.43
83 0.41
84 0.4
85 0.37
86 0.33
87 0.25
88 0.18
89 0.13
90 0.1
91 0.08
92 0.1
93 0.12
94 0.13
95 0.14
96 0.14
97 0.18
98 0.19
99 0.24
100 0.26
101 0.25
102 0.25
103 0.3
104 0.31
105 0.35
106 0.39
107 0.38
108 0.4
109 0.4
110 0.4
111 0.35
112 0.36
113 0.32
114 0.28
115 0.24
116 0.21
117 0.23
118 0.23
119 0.25
120 0.26
121 0.27
122 0.27
123 0.3
124 0.33
125 0.33
126 0.32
127 0.28
128 0.26
129 0.21
130 0.2
131 0.17
132 0.1
133 0.08
134 0.11
135 0.1
136 0.11
137 0.11
138 0.13
139 0.14
140 0.18
141 0.19
142 0.18
143 0.2
144 0.26
145 0.29
146 0.28
147 0.27
148 0.25
149 0.25
150 0.24
151 0.21
152 0.15
153 0.13
154 0.15
155 0.15
156 0.14
157 0.14
158 0.17
159 0.19
160 0.2
161 0.2
162 0.17
163 0.14
164 0.16
165 0.15
166 0.12
167 0.1
168 0.08
169 0.08
170 0.07
171 0.07
172 0.05
173 0.05
174 0.06
175 0.06
176 0.06
177 0.07
178 0.08
179 0.08
180 0.11
181 0.13
182 0.13
183 0.16
184 0.18
185 0.19
186 0.2
187 0.22
188 0.22
189 0.23
190 0.24
191 0.22
192 0.21
193 0.2
194 0.19
195 0.16
196 0.16
197 0.14
198 0.16
199 0.14
200 0.13
201 0.13
202 0.12
203 0.12
204 0.12
205 0.11
206 0.08
207 0.14
208 0.15
209 0.17
210 0.17
211 0.17
212 0.16
213 0.17
214 0.16
215 0.1
216 0.1
217 0.09
218 0.1
219 0.11
220 0.12
221 0.14
222 0.2
223 0.25
224 0.3
225 0.31
226 0.32
227 0.31
228 0.39
229 0.4
230 0.37
231 0.41
232 0.41
233 0.47
234 0.54
235 0.54
236 0.49
237 0.51
238 0.5
239 0.46
240 0.49
241 0.48
242 0.49
243 0.54
244 0.5
245 0.48
246 0.47
247 0.47
248 0.5
249 0.45
250 0.39
251 0.37
252 0.38
253 0.37
254 0.36
255 0.34
256 0.27
257 0.27
258 0.24
259 0.19
260 0.18
261 0.17
262 0.18
263 0.17
264 0.16
265 0.15
266 0.15
267 0.15
268 0.15
269 0.15
270 0.13
271 0.11
272 0.09
273 0.07
274 0.06
275 0.06
276 0.05
277 0.04
278 0.04
279 0.05
280 0.06
281 0.06
282 0.07
283 0.09
284 0.1
285 0.1
286 0.11
287 0.1
288 0.1
289 0.12
290 0.14
291 0.15
292 0.2
293 0.2
294 0.19
295 0.19
296 0.19
297 0.19
298 0.19
299 0.17
300 0.12
301 0.14
302 0.15
303 0.14
304 0.14
305 0.13
306 0.11
307 0.09
308 0.09
309 0.08
310 0.07
311 0.07
312 0.06
313 0.07
314 0.08
315 0.08
316 0.11
317 0.11
318 0.12
319 0.12
320 0.13
321 0.13
322 0.12
323 0.14
324 0.11
325 0.11
326 0.1
327 0.12
328 0.13
329 0.15
330 0.16
331 0.2
332 0.26
333 0.28
334 0.33
335 0.38
336 0.44
337 0.5
338 0.57
339 0.59
340 0.57
341 0.62
342 0.59
343 0.56
344 0.49
345 0.42
346 0.38
347 0.33
348 0.37
349 0.39
350 0.46
351 0.44
352 0.46
353 0.5
354 0.55
355 0.6
356 0.55
357 0.52
358 0.43
359 0.46
360 0.5
361 0.51
362 0.48
363 0.46
364 0.45
365 0.43
366 0.44
367 0.46
368 0.5
369 0.56
370 0.59
371 0.63
372 0.7
373 0.72
374 0.74
375 0.72
376 0.68
377 0.66
378 0.66
379 0.67
380 0.67
381 0.72
382 0.79
383 0.85
384 0.87
385 0.89
386 0.91
387 0.9
388 0.9
389 0.91
390 0.91
391 0.92
392 0.95
393 0.95
394 0.95
395 0.96