Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LPE9

Protein Details
Accession A0A4Q9LPE9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
124-144IENRQRVRKNESRPLKPRFFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037239  OSBP_sf  
IPR000648  Oxysterol-bd  
Gene Ontology GO:0008289  F:lipid binding  
Pfam View protein in Pfam  
PF01237  Oxysterol_BP  
Amino Acid Sequences NGKIELECGDIKGIIKIKPSKSRDEINVCGSVKQKNKTVYSFKGIWDKYLLCRDMDTGNEFYVYESNERRFPEYYNMTKYSFQLNFITSEIESKMFYTDSRYRPDTRALEYGQFANALENNEIIENRQRVRKNESRPLKPRFFEFNNNLWTWKGCDDTGKGERIFEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.33
4 0.4
5 0.49
6 0.52
7 0.56
8 0.58
9 0.63
10 0.64
11 0.64
12 0.61
13 0.56
14 0.58
15 0.5
16 0.48
17 0.43
18 0.42
19 0.4
20 0.4
21 0.42
22 0.42
23 0.46
24 0.5
25 0.56
26 0.53
27 0.53
28 0.5
29 0.47
30 0.49
31 0.45
32 0.39
33 0.35
34 0.32
35 0.3
36 0.34
37 0.32
38 0.24
39 0.24
40 0.24
41 0.22
42 0.22
43 0.21
44 0.15
45 0.14
46 0.14
47 0.14
48 0.13
49 0.13
50 0.12
51 0.11
52 0.12
53 0.14
54 0.18
55 0.18
56 0.21
57 0.2
58 0.21
59 0.25
60 0.29
61 0.31
62 0.33
63 0.34
64 0.34
65 0.34
66 0.33
67 0.32
68 0.26
69 0.24
70 0.2
71 0.19
72 0.18
73 0.17
74 0.17
75 0.11
76 0.11
77 0.1
78 0.09
79 0.08
80 0.07
81 0.08
82 0.07
83 0.07
84 0.13
85 0.2
86 0.23
87 0.28
88 0.31
89 0.33
90 0.35
91 0.42
92 0.38
93 0.35
94 0.36
95 0.33
96 0.31
97 0.3
98 0.29
99 0.22
100 0.19
101 0.15
102 0.12
103 0.11
104 0.11
105 0.1
106 0.09
107 0.09
108 0.1
109 0.1
110 0.1
111 0.15
112 0.17
113 0.19
114 0.26
115 0.3
116 0.34
117 0.43
118 0.5
119 0.53
120 0.6
121 0.68
122 0.71
123 0.76
124 0.81
125 0.8
126 0.74
127 0.7
128 0.68
129 0.64
130 0.63
131 0.61
132 0.59
133 0.57
134 0.55
135 0.51
136 0.44
137 0.4
138 0.33
139 0.3
140 0.25
141 0.2
142 0.24
143 0.25
144 0.33
145 0.36
146 0.39
147 0.36