Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JY73

Protein Details
Accession A0A4V2JY73   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-35MEKQLNKNARKIKNNTKAILHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.833, cyto 10, cyto_pero 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
Amino Acid Sequences MVNMNLVDLKVEINEMEKQLNKNARKIKNNTKAILPRELVDYYTSESIKYKELITRLKIFVSQIEKTKLKKNLNNLITNIRLKKYDEIYKKLEEFEIELKMMDGIVPDEESDIDLFDDILKDIITKRYLVAIDKFMNICLENGYELFSTDLIEKCKNEQCLICKSRLKYIGMLSITGDDIKDIEYIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.18
4 0.21
5 0.23
6 0.3
7 0.39
8 0.4
9 0.46
10 0.54
11 0.59
12 0.65
13 0.72
14 0.75
15 0.77
16 0.81
17 0.74
18 0.73
19 0.72
20 0.67
21 0.65
22 0.55
23 0.45
24 0.41
25 0.39
26 0.31
27 0.25
28 0.22
29 0.17
30 0.19
31 0.18
32 0.15
33 0.16
34 0.17
35 0.18
36 0.17
37 0.16
38 0.17
39 0.22
40 0.27
41 0.3
42 0.34
43 0.33
44 0.32
45 0.32
46 0.29
47 0.28
48 0.28
49 0.26
50 0.25
51 0.3
52 0.33
53 0.34
54 0.42
55 0.45
56 0.48
57 0.49
58 0.54
59 0.57
60 0.59
61 0.6
62 0.55
63 0.5
64 0.47
65 0.47
66 0.4
67 0.31
68 0.27
69 0.25
70 0.27
71 0.27
72 0.31
73 0.33
74 0.36
75 0.38
76 0.4
77 0.39
78 0.36
79 0.31
80 0.23
81 0.2
82 0.16
83 0.14
84 0.11
85 0.1
86 0.09
87 0.09
88 0.08
89 0.06
90 0.04
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.06
110 0.09
111 0.1
112 0.1
113 0.11
114 0.14
115 0.15
116 0.17
117 0.18
118 0.2
119 0.21
120 0.23
121 0.23
122 0.2
123 0.2
124 0.18
125 0.15
126 0.11
127 0.1
128 0.09
129 0.09
130 0.1
131 0.09
132 0.09
133 0.09
134 0.08
135 0.09
136 0.1
137 0.13
138 0.14
139 0.17
140 0.18
141 0.22
142 0.28
143 0.3
144 0.31
145 0.33
146 0.36
147 0.43
148 0.46
149 0.48
150 0.49
151 0.49
152 0.54
153 0.55
154 0.52
155 0.46
156 0.47
157 0.47
158 0.41
159 0.4
160 0.32
161 0.27
162 0.25
163 0.21
164 0.17
165 0.09
166 0.09
167 0.09
168 0.09