Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9M2X6

Protein Details
Accession A0A4Q9M2X6    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-83IFKSVNKNKKENSKKAVNKKEFKQKTVEVENNKNKFKKPKKNESKLFNESSGITDKTQKEKKKNYKKQKDSENSNEDHydrophilic
NLS Segment(s)
PositionSequence
13-49KNKKENSKKAVNKKEFKQKTVEVENNKNKFKKPKKNE
65-70KEKKKN
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSEIDEIFKSVNKNKKENSKKAVNKKEFKQKTVEVENNKNKFKKPKKNESKLFNESSGITDKTQKEKKKNYKKQKDSENSNEDQNKSRFTSEGLPLLSEEALHIGKGGKSKLCPFDCDCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.61
3 0.69
4 0.74
5 0.75
6 0.77
7 0.81
8 0.84
9 0.88
10 0.87
11 0.85
12 0.83
13 0.86
14 0.81
15 0.74
16 0.71
17 0.64
18 0.62
19 0.63
20 0.62
21 0.58
22 0.62
23 0.69
24 0.68
25 0.69
26 0.64
27 0.6
28 0.63
29 0.66
30 0.67
31 0.68
32 0.73
33 0.78
34 0.86
35 0.89
36 0.86
37 0.84
38 0.79
39 0.72
40 0.61
41 0.51
42 0.41
43 0.34
44 0.29
45 0.21
46 0.16
47 0.18
48 0.19
49 0.26
50 0.33
51 0.37
52 0.43
53 0.53
54 0.63
55 0.69
56 0.78
57 0.82
58 0.86
59 0.9
60 0.9
61 0.9
62 0.88
63 0.85
64 0.84
65 0.79
66 0.7
67 0.67
68 0.63
69 0.54
70 0.52
71 0.44
72 0.38
73 0.34
74 0.33
75 0.26
76 0.25
77 0.29
78 0.25
79 0.28
80 0.25
81 0.23
82 0.22
83 0.23
84 0.2
85 0.14
86 0.11
87 0.09
88 0.09
89 0.08
90 0.08
91 0.09
92 0.11
93 0.15
94 0.18
95 0.19
96 0.24
97 0.31
98 0.4
99 0.41
100 0.44
101 0.46