Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JXA9

Protein Details
Accession A0A4V2JXA9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
72-96MEDLKNNKSTTRKNNKRGKKGMQKKHydrophilic
NLS Segment(s)
PositionSequence
82-96TRKNNKRGKKGMQKK
Subcellular Location(s) nucl 18, cyto_nucl 14.833, cyto 7.5, cyto_pero 4.832
Family & Domain DBs
Amino Acid Sequences MNEEKDELLDKMPEKVISYFYKTEILKDADELKECNQRLNELESFQIYKEIKNSEVKKKIESQDPALVKAYMEDLKNNKSTTRKNNKRGKKGMQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.24
4 0.24
5 0.29
6 0.27
7 0.26
8 0.32
9 0.29
10 0.3
11 0.3
12 0.29
13 0.23
14 0.24
15 0.26
16 0.22
17 0.23
18 0.23
19 0.21
20 0.26
21 0.25
22 0.27
23 0.24
24 0.23
25 0.24
26 0.27
27 0.25
28 0.19
29 0.19
30 0.16
31 0.17
32 0.15
33 0.18
34 0.13
35 0.13
36 0.14
37 0.15
38 0.16
39 0.24
40 0.29
41 0.33
42 0.41
43 0.42
44 0.42
45 0.48
46 0.5
47 0.5
48 0.49
49 0.45
50 0.45
51 0.45
52 0.43
53 0.38
54 0.33
55 0.25
56 0.22
57 0.2
58 0.15
59 0.15
60 0.18
61 0.2
62 0.25
63 0.29
64 0.29
65 0.31
66 0.36
67 0.44
68 0.51
69 0.58
70 0.65
71 0.71
72 0.81
73 0.87
74 0.9
75 0.91
76 0.91