Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9M2I5

Protein Details
Accession A0A4Q9M2I5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-87QKAASKDKRIPKEKKPTLQVHydrophilic
NLS Segment(s)
PositionSequence
73-81KDKRIPKEK
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003923  TFIID_30kDa  
Gene Ontology GO:0005634  C:nucleus  
GO:0003743  F:translation initiation factor activity  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF03540  TFIID_30kDa  
CDD cd07982  TAF10  
Amino Acid Sequences MDDESFNKFKENLEEFTPLIPDVVIDHFLERSGIEHCDENVRKMISLMTQKFITDISTSSFQYHKINQKAASKDKRIPKEKKPTLQVADLEKALEEQGINISRPYYFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.31
4 0.3
5 0.21
6 0.17
7 0.14
8 0.1
9 0.08
10 0.09
11 0.1
12 0.09
13 0.09
14 0.09
15 0.1
16 0.1
17 0.08
18 0.08
19 0.08
20 0.09
21 0.09
22 0.1
23 0.1
24 0.19
25 0.2
26 0.2
27 0.22
28 0.21
29 0.2
30 0.2
31 0.2
32 0.15
33 0.22
34 0.21
35 0.2
36 0.2
37 0.2
38 0.2
39 0.19
40 0.16
41 0.09
42 0.09
43 0.09
44 0.11
45 0.11
46 0.12
47 0.13
48 0.13
49 0.16
50 0.21
51 0.27
52 0.29
53 0.33
54 0.36
55 0.42
56 0.47
57 0.54
58 0.57
59 0.54
60 0.57
61 0.62
62 0.67
63 0.71
64 0.72
65 0.72
66 0.75
67 0.79
68 0.8
69 0.78
70 0.77
71 0.72
72 0.7
73 0.64
74 0.58
75 0.52
76 0.44
77 0.37
78 0.28
79 0.24
80 0.19
81 0.15
82 0.09
83 0.07
84 0.12
85 0.14
86 0.15
87 0.15
88 0.16