Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JXH0

Protein Details
Accession A0A4V2JXH0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-23TVFSNSVKKRIKEKNNSECLKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTVFSNSVKKRIKEKNNSECLKNEKLNSVNNSKKKIHEIKSGNTDSISKREKTLSPMAIIKLSNYDLKYLLVSKSLSHKNNLDVAQLAELYGKIEKRKFHIKLYSIQKKEVNVSDSTRWLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.84
4 0.84
5 0.77
6 0.73
7 0.69
8 0.65
9 0.59
10 0.5
11 0.46
12 0.47
13 0.5
14 0.49
15 0.52
16 0.53
17 0.54
18 0.59
19 0.55
20 0.54
21 0.57
22 0.6
23 0.56
24 0.57
25 0.56
26 0.56
27 0.62
28 0.61
29 0.52
30 0.43
31 0.4
32 0.32
33 0.34
34 0.32
35 0.23
36 0.23
37 0.26
38 0.26
39 0.29
40 0.34
41 0.28
42 0.26
43 0.28
44 0.27
45 0.25
46 0.24
47 0.18
48 0.13
49 0.13
50 0.14
51 0.12
52 0.12
53 0.11
54 0.11
55 0.12
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.17
62 0.24
63 0.25
64 0.27
65 0.29
66 0.29
67 0.35
68 0.34
69 0.28
70 0.22
71 0.21
72 0.18
73 0.16
74 0.13
75 0.08
76 0.08
77 0.08
78 0.09
79 0.11
80 0.15
81 0.19
82 0.22
83 0.27
84 0.38
85 0.41
86 0.47
87 0.53
88 0.52
89 0.58
90 0.66
91 0.71
92 0.63
93 0.65
94 0.6
95 0.54
96 0.57
97 0.53
98 0.46
99 0.39
100 0.41
101 0.4