Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9M0S2

Protein Details
Accession A0A4Q9M0S2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-75VLCSNLNNRKNKKYKYINTDVLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 7, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045886  ThiF/MoeB/HesA  
IPR000594  ThiF_NAD_FAD-bd  
IPR035985  Ubiquitin-activating_enz  
Gene Ontology GO:0019781  F:NEDD8 activating enzyme activity  
GO:0045116  P:protein neddylation  
Pfam View protein in Pfam  
PF00899  ThiF  
Amino Acid Sequences MQILVLGSELIKLLITQKEYKITLLDYDEIEISNLNRQFMYLKKDIGKNKAEVLCSNLNNRKNKKYKYINTDVLKLKEEDIKHFDIIISCLDNIVARMHINFLIKKSVKNIFFIDSGVENMKIHVKVVKKGFSCLYCIKEMYNTQVNLSFCTIKNIEKNLSKYSRHQIILSLIIQFKEKAKENLSYLSNNLPGDLTKDLSNNLTKDLSNNLENNLSNNLTKDLESNLSKDLSNTLESNLSKDLSNTLECKLPKDLSNNSTKDLSNNLENNLESNLTKDLSNNLNKIISKPNKISIDSNNRNISNFIESVKLKFNELALSNNLKPTNSFEIIGIERDIIPNVCYINSIAASLIFKEIKSIKSNKEYDYIFYNSEYKIYTQKFLLSKSDSCILCNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.23
4 0.26
5 0.32
6 0.33
7 0.34
8 0.32
9 0.29
10 0.29
11 0.27
12 0.26
13 0.21
14 0.21
15 0.21
16 0.19
17 0.17
18 0.15
19 0.12
20 0.17
21 0.18
22 0.18
23 0.17
24 0.17
25 0.2
26 0.24
27 0.31
28 0.27
29 0.31
30 0.37
31 0.45
32 0.51
33 0.56
34 0.57
35 0.52
36 0.57
37 0.55
38 0.51
39 0.45
40 0.45
41 0.44
42 0.41
43 0.47
44 0.47
45 0.49
46 0.57
47 0.62
48 0.66
49 0.69
50 0.73
51 0.75
52 0.78
53 0.8
54 0.81
55 0.83
56 0.82
57 0.76
58 0.77
59 0.73
60 0.64
61 0.58
62 0.49
63 0.41
64 0.38
65 0.35
66 0.33
67 0.33
68 0.33
69 0.31
70 0.3
71 0.29
72 0.24
73 0.24
74 0.2
75 0.15
76 0.12
77 0.11
78 0.11
79 0.1
80 0.1
81 0.09
82 0.08
83 0.07
84 0.08
85 0.09
86 0.12
87 0.15
88 0.16
89 0.17
90 0.25
91 0.26
92 0.27
93 0.3
94 0.36
95 0.34
96 0.35
97 0.36
98 0.3
99 0.29
100 0.28
101 0.24
102 0.17
103 0.17
104 0.15
105 0.14
106 0.11
107 0.11
108 0.15
109 0.13
110 0.13
111 0.16
112 0.17
113 0.22
114 0.28
115 0.34
116 0.3
117 0.33
118 0.37
119 0.34
120 0.36
121 0.34
122 0.32
123 0.28
124 0.28
125 0.25
126 0.25
127 0.25
128 0.25
129 0.27
130 0.24
131 0.23
132 0.26
133 0.26
134 0.24
135 0.25
136 0.22
137 0.16
138 0.2
139 0.21
140 0.19
141 0.23
142 0.25
143 0.28
144 0.3
145 0.33
146 0.36
147 0.4
148 0.4
149 0.41
150 0.45
151 0.47
152 0.43
153 0.4
154 0.35
155 0.31
156 0.32
157 0.28
158 0.23
159 0.17
160 0.16
161 0.16
162 0.15
163 0.15
164 0.16
165 0.17
166 0.18
167 0.2
168 0.23
169 0.24
170 0.28
171 0.27
172 0.24
173 0.23
174 0.22
175 0.21
176 0.18
177 0.17
178 0.12
179 0.1
180 0.12
181 0.11
182 0.1
183 0.08
184 0.09
185 0.1
186 0.12
187 0.14
188 0.12
189 0.13
190 0.13
191 0.12
192 0.13
193 0.15
194 0.15
195 0.15
196 0.16
197 0.15
198 0.16
199 0.16
200 0.17
201 0.16
202 0.15
203 0.13
204 0.13
205 0.13
206 0.11
207 0.12
208 0.11
209 0.11
210 0.14
211 0.14
212 0.15
213 0.15
214 0.15
215 0.15
216 0.14
217 0.14
218 0.12
219 0.13
220 0.12
221 0.12
222 0.15
223 0.15
224 0.17
225 0.16
226 0.15
227 0.14
228 0.13
229 0.14
230 0.12
231 0.14
232 0.13
233 0.13
234 0.17
235 0.17
236 0.2
237 0.21
238 0.21
239 0.23
240 0.27
241 0.31
242 0.31
243 0.4
244 0.39
245 0.38
246 0.39
247 0.35
248 0.31
249 0.29
250 0.27
251 0.25
252 0.25
253 0.25
254 0.24
255 0.23
256 0.23
257 0.2
258 0.18
259 0.12
260 0.12
261 0.12
262 0.11
263 0.11
264 0.11
265 0.14
266 0.2
267 0.24
268 0.24
269 0.24
270 0.27
271 0.27
272 0.3
273 0.36
274 0.35
275 0.37
276 0.39
277 0.45
278 0.46
279 0.48
280 0.49
281 0.48
282 0.53
283 0.54
284 0.58
285 0.56
286 0.52
287 0.51
288 0.48
289 0.4
290 0.33
291 0.27
292 0.21
293 0.21
294 0.21
295 0.22
296 0.29
297 0.27
298 0.24
299 0.24
300 0.24
301 0.24
302 0.24
303 0.25
304 0.22
305 0.28
306 0.27
307 0.31
308 0.31
309 0.26
310 0.26
311 0.29
312 0.32
313 0.28
314 0.27
315 0.23
316 0.27
317 0.28
318 0.28
319 0.23
320 0.16
321 0.15
322 0.15
323 0.16
324 0.12
325 0.11
326 0.11
327 0.11
328 0.1
329 0.11
330 0.11
331 0.12
332 0.12
333 0.12
334 0.1
335 0.11
336 0.12
337 0.11
338 0.15
339 0.13
340 0.13
341 0.18
342 0.21
343 0.24
344 0.31
345 0.37
346 0.41
347 0.5
348 0.54
349 0.52
350 0.55
351 0.52
352 0.48
353 0.47
354 0.42
355 0.34
356 0.32
357 0.32
358 0.26
359 0.26
360 0.25
361 0.21
362 0.27
363 0.28
364 0.29
365 0.28
366 0.35
367 0.37
368 0.38
369 0.44
370 0.4
371 0.4
372 0.41
373 0.47
374 0.4
375 0.38