Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JXU8

Protein Details
Accession A0A4V2JXU8   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
156-176LEMKKNKLYFVKKKNIKHLIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036224  GINS_bundle-like_dom_sf  
IPR005339  GINS_Psf1  
Gene Ontology GO:0000811  C:GINS complex  
GO:0006260  P:DNA replication  
Amino Acid Sequences MKFGKSGIELLNDCKMKVLTPINKISLQKIESENNLLEEKMKEVREKAERNEVSEKLSTDYFLLKKFKERNERIRIAYQFSRCIKIQNNYFKKDKIQHLLSDEENKHSFQSKQIFDEYFSEFGILDFIDEDPPLNNFVQILTLDNCGVVLDGNDFLEMKKNKLYFVKKKNIKHLIDQGLVKMINN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.21
4 0.27
5 0.33
6 0.32
7 0.38
8 0.44
9 0.45
10 0.5
11 0.51
12 0.48
13 0.45
14 0.39
15 0.36
16 0.35
17 0.35
18 0.33
19 0.35
20 0.31
21 0.28
22 0.28
23 0.23
24 0.2
25 0.17
26 0.18
27 0.19
28 0.2
29 0.2
30 0.21
31 0.28
32 0.35
33 0.39
34 0.4
35 0.46
36 0.45
37 0.48
38 0.51
39 0.45
40 0.4
41 0.37
42 0.34
43 0.25
44 0.24
45 0.2
46 0.15
47 0.18
48 0.16
49 0.19
50 0.21
51 0.2
52 0.27
53 0.33
54 0.4
55 0.47
56 0.53
57 0.59
58 0.65
59 0.69
60 0.66
61 0.66
62 0.6
63 0.54
64 0.52
65 0.43
66 0.41
67 0.38
68 0.38
69 0.31
70 0.33
71 0.32
72 0.33
73 0.38
74 0.42
75 0.47
76 0.47
77 0.5
78 0.47
79 0.47
80 0.48
81 0.45
82 0.42
83 0.38
84 0.36
85 0.37
86 0.38
87 0.34
88 0.35
89 0.3
90 0.27
91 0.25
92 0.23
93 0.21
94 0.21
95 0.2
96 0.19
97 0.26
98 0.24
99 0.26
100 0.28
101 0.28
102 0.27
103 0.29
104 0.26
105 0.19
106 0.17
107 0.15
108 0.12
109 0.11
110 0.1
111 0.07
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.07
120 0.09
121 0.08
122 0.08
123 0.07
124 0.08
125 0.09
126 0.09
127 0.11
128 0.1
129 0.11
130 0.11
131 0.11
132 0.1
133 0.09
134 0.09
135 0.06
136 0.05
137 0.05
138 0.06
139 0.06
140 0.07
141 0.07
142 0.07
143 0.16
144 0.17
145 0.18
146 0.24
147 0.24
148 0.28
149 0.37
150 0.47
151 0.49
152 0.58
153 0.67
154 0.7
155 0.77
156 0.84
157 0.85
158 0.79
159 0.77
160 0.77
161 0.74
162 0.71
163 0.64
164 0.55
165 0.5