Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LPF8

Protein Details
Accession A0A4Q9LPF8   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
98-125ALKLLKINKKFDKKPNKLFERRLKLFIKHydrophilic
NLS Segment(s)
PositionSequence
100-127KLLKINKKFDKKPNKLFERRLKLFIKKL
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKKTKFISKPTHFLCNAFEIEDLNEFKSLELNANSFYCYLYLASKNLYSLDLLPIFENKREKLKLLYNYIHYKGGNSKSTDSVNSTGKKLSEKDVKTALKLLKINKKFDKKPNKLFERRLKLFIKKLIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.39
4 0.3
5 0.26
6 0.18
7 0.18
8 0.2
9 0.18
10 0.15
11 0.15
12 0.14
13 0.13
14 0.14
15 0.14
16 0.13
17 0.14
18 0.13
19 0.15
20 0.15
21 0.16
22 0.14
23 0.13
24 0.1
25 0.09
26 0.09
27 0.1
28 0.11
29 0.11
30 0.13
31 0.13
32 0.13
33 0.13
34 0.13
35 0.1
36 0.09
37 0.11
38 0.1
39 0.1
40 0.1
41 0.12
42 0.13
43 0.15
44 0.17
45 0.16
46 0.21
47 0.21
48 0.22
49 0.24
50 0.3
51 0.32
52 0.35
53 0.36
54 0.35
55 0.39
56 0.4
57 0.38
58 0.31
59 0.27
60 0.27
61 0.29
62 0.29
63 0.26
64 0.26
65 0.26
66 0.28
67 0.28
68 0.25
69 0.23
70 0.25
71 0.25
72 0.24
73 0.23
74 0.23
75 0.25
76 0.24
77 0.28
78 0.32
79 0.31
80 0.35
81 0.42
82 0.42
83 0.4
84 0.45
85 0.39
86 0.37
87 0.39
88 0.43
89 0.44
90 0.49
91 0.56
92 0.6
93 0.67
94 0.69
95 0.76
96 0.79
97 0.79
98 0.84
99 0.86
100 0.87
101 0.87
102 0.89
103 0.9
104 0.89
105 0.84
106 0.81
107 0.77
108 0.75
109 0.73
110 0.7