Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LR04

Protein Details
Accession A0A4Q9LR04    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-29NSEKRDSKYKQLTKEQRQGIHydrophilic
55-80EKARYVPMFLQKRKKRCGRKPKEYSNHydrophilic
NLS Segment(s)
PositionSequence
66-76KRKKRCGRKPK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.333, mito_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MENVEENLLNSEKRDSKYKQLTKEQRQGILEKLLQQMKENKLKHEFGMQHKLNTEKARYVPMFLQKRKKRCGRKPKEYSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.42
4 0.53
5 0.59
6 0.62
7 0.67
8 0.75
9 0.77
10 0.82
11 0.76
12 0.7
13 0.65
14 0.59
15 0.5
16 0.44
17 0.35
18 0.3
19 0.3
20 0.27
21 0.25
22 0.26
23 0.29
24 0.3
25 0.38
26 0.35
27 0.34
28 0.37
29 0.38
30 0.36
31 0.37
32 0.36
33 0.34
34 0.43
35 0.4
36 0.37
37 0.38
38 0.4
39 0.38
40 0.36
41 0.32
42 0.26
43 0.27
44 0.32
45 0.31
46 0.32
47 0.31
48 0.37
49 0.45
50 0.48
51 0.58
52 0.59
53 0.67
54 0.75
55 0.81
56 0.82
57 0.84
58 0.88
59 0.88
60 0.91