Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LC25

Protein Details
Accession A0A4Q9LC25    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
181-208IQELRKLRRNEKKVKNKKIKKIFYNKLTHydrophilic
NLS Segment(s)
PositionSequence
185-201RKLRRNEKKVKNKKIKK
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR005097  Sacchrp_dh_NADP  
Gene Ontology GO:0016020  C:membrane  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF03435  Sacchrp_dh_NADP  
Amino Acid Sequences MKEYDIIIYGASGYTARFVIERLIKEQKRIALAGRSLSNINKNIISLDLKEDIEIFEVTVDNIDIITSKTKVLVNCCGPYIFTGEKIVKSCIEHRTHYLDITGETLFIERILNKYGEMAKRNGVFILNCCGFDSVPADMGFEYLKKHMNVDNFECESVMSLKNSFVNVATYQSLIYGLGNIQELRKLRRNEKKVKNKKIKKIFYNKLTQSYCVIFMGTDASVVKRSQNMLEEHDLSKKGEYSAYFEVGSLKNLILFMFYFGMIYFLSKFKFGRKILLAFPGFFSCYRIKPNGPTLSEIENASFSIVFWGKGVASNGEIIRNKLKIDGGDPGYITTATCLTHCTVVLLNMLEEKEMGIKNSLSLLEGGIFTPASVFSETDLIDRLCLKGVNFNIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.09
6 0.16
7 0.22
8 0.24
9 0.29
10 0.4
11 0.41
12 0.46
13 0.5
14 0.48
15 0.45
16 0.45
17 0.43
18 0.4
19 0.41
20 0.42
21 0.38
22 0.36
23 0.34
24 0.36
25 0.38
26 0.34
27 0.33
28 0.29
29 0.27
30 0.26
31 0.27
32 0.25
33 0.2
34 0.21
35 0.22
36 0.21
37 0.21
38 0.2
39 0.17
40 0.17
41 0.15
42 0.11
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.09
54 0.09
55 0.1
56 0.13
57 0.16
58 0.19
59 0.23
60 0.3
61 0.32
62 0.33
63 0.34
64 0.31
65 0.29
66 0.27
67 0.28
68 0.21
69 0.16
70 0.2
71 0.21
72 0.24
73 0.25
74 0.26
75 0.23
76 0.25
77 0.29
78 0.32
79 0.35
80 0.35
81 0.37
82 0.42
83 0.41
84 0.38
85 0.34
86 0.26
87 0.22
88 0.21
89 0.17
90 0.1
91 0.09
92 0.09
93 0.08
94 0.07
95 0.08
96 0.07
97 0.08
98 0.11
99 0.11
100 0.11
101 0.14
102 0.19
103 0.23
104 0.26
105 0.26
106 0.28
107 0.3
108 0.3
109 0.28
110 0.23
111 0.19
112 0.18
113 0.23
114 0.19
115 0.18
116 0.18
117 0.18
118 0.16
119 0.16
120 0.16
121 0.09
122 0.11
123 0.1
124 0.1
125 0.09
126 0.1
127 0.09
128 0.08
129 0.09
130 0.08
131 0.12
132 0.12
133 0.14
134 0.17
135 0.21
136 0.25
137 0.28
138 0.32
139 0.29
140 0.29
141 0.27
142 0.23
143 0.2
144 0.17
145 0.15
146 0.1
147 0.09
148 0.1
149 0.11
150 0.12
151 0.11
152 0.09
153 0.1
154 0.1
155 0.11
156 0.11
157 0.1
158 0.09
159 0.09
160 0.09
161 0.07
162 0.06
163 0.05
164 0.04
165 0.05
166 0.06
167 0.06
168 0.06
169 0.08
170 0.1
171 0.14
172 0.22
173 0.25
174 0.34
175 0.43
176 0.52
177 0.6
178 0.7
179 0.76
180 0.8
181 0.87
182 0.89
183 0.89
184 0.89
185 0.89
186 0.87
187 0.85
188 0.85
189 0.82
190 0.78
191 0.78
192 0.7
193 0.68
194 0.61
195 0.52
196 0.44
197 0.36
198 0.31
199 0.21
200 0.19
201 0.1
202 0.09
203 0.09
204 0.07
205 0.06
206 0.05
207 0.06
208 0.08
209 0.08
210 0.09
211 0.09
212 0.11
213 0.12
214 0.16
215 0.17
216 0.2
217 0.23
218 0.25
219 0.24
220 0.26
221 0.25
222 0.21
223 0.2
224 0.17
225 0.14
226 0.14
227 0.13
228 0.16
229 0.17
230 0.18
231 0.17
232 0.17
233 0.19
234 0.18
235 0.18
236 0.13
237 0.11
238 0.1
239 0.1
240 0.1
241 0.07
242 0.07
243 0.07
244 0.07
245 0.07
246 0.07
247 0.06
248 0.07
249 0.07
250 0.07
251 0.07
252 0.08
253 0.09
254 0.1
255 0.11
256 0.16
257 0.24
258 0.24
259 0.3
260 0.33
261 0.35
262 0.36
263 0.44
264 0.4
265 0.32
266 0.32
267 0.27
268 0.24
269 0.21
270 0.22
271 0.17
272 0.19
273 0.23
274 0.26
275 0.27
276 0.31
277 0.4
278 0.44
279 0.42
280 0.43
281 0.41
282 0.4
283 0.39
284 0.35
285 0.26
286 0.19
287 0.18
288 0.15
289 0.12
290 0.08
291 0.11
292 0.11
293 0.1
294 0.1
295 0.11
296 0.1
297 0.13
298 0.14
299 0.11
300 0.11
301 0.14
302 0.15
303 0.2
304 0.21
305 0.21
306 0.25
307 0.25
308 0.25
309 0.24
310 0.26
311 0.21
312 0.22
313 0.27
314 0.25
315 0.26
316 0.26
317 0.24
318 0.23
319 0.21
320 0.19
321 0.12
322 0.1
323 0.09
324 0.09
325 0.11
326 0.11
327 0.13
328 0.13
329 0.13
330 0.13
331 0.14
332 0.16
333 0.14
334 0.13
335 0.14
336 0.14
337 0.13
338 0.12
339 0.11
340 0.13
341 0.13
342 0.14
343 0.15
344 0.15
345 0.15
346 0.18
347 0.18
348 0.14
349 0.13
350 0.13
351 0.11
352 0.12
353 0.11
354 0.1
355 0.09
356 0.08
357 0.08
358 0.08
359 0.09
360 0.09
361 0.09
362 0.1
363 0.13
364 0.14
365 0.14
366 0.17
367 0.15
368 0.15
369 0.16
370 0.16
371 0.15
372 0.17
373 0.16
374 0.21