Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LTI2

Protein Details
Accession A0A4Q9LTI2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
68-90VLKPPCTKPRKVNEPTGKRPDKAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17.5, cyto_nucl 13.833, nucl 9, mito_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MTNEKGYVPIWSGHPDPFPVSLSVSLFNDSYKATLGNISQEFLEGKVEVSVIPLIFQEKLGVGLKTHVLKPPCTKPRKVNEPTGKRPDKACMSCSPEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.22
5 0.21
6 0.18
7 0.18
8 0.17
9 0.17
10 0.17
11 0.16
12 0.16
13 0.14
14 0.13
15 0.12
16 0.11
17 0.1
18 0.09
19 0.08
20 0.07
21 0.09
22 0.09
23 0.13
24 0.13
25 0.13
26 0.12
27 0.12
28 0.12
29 0.11
30 0.11
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.06
38 0.05
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.08
47 0.09
48 0.09
49 0.08
50 0.09
51 0.12
52 0.14
53 0.16
54 0.18
55 0.19
56 0.22
57 0.29
58 0.38
59 0.45
60 0.5
61 0.55
62 0.6
63 0.68
64 0.75
65 0.75
66 0.75
67 0.76
68 0.8
69 0.83
70 0.85
71 0.8
72 0.72
73 0.69
74 0.66
75 0.65
76 0.6
77 0.55
78 0.52
79 0.54